CAZyme Information: MGYG000000098_01366

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01366
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367		42667.32	9.5938

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 182138; End: 183241 Strand: -

Full Sequence      

MSKKLFIFVFLLPFQLLLAQSSQLTDFPEGYTPEEVGKRLAYRFVDGKHALHAGKWISYP
ETFNWNGALQLAKITKDKKLFKLLENKFEPLFTTEKKLLPIMNHVDLNMFGSLPLNLYQM
TKKKKYLKLGLPYADTQWEVPENAKPSEKEWAGKGYSWQTRLWIDDMYMITIVQTQAYKV
TKDRKYIDRAAKEMVLYLDELQRPNGLFYHAPDVPFYWGRGNGWMAAGMTELLRNLPKNH
PNRERIMQGYHTMMKSLLDYQTSSGMWNQLIDQPDCWAETSGSAMFTFAFIVGVKNGWLD
AEVYGPAARKAWMALVSYINDKGAVREVCVGTNKKNSKQYYYDRPRNTGDYHGQAPYLWC
TVALLEK

Enzyme Prediction     

No EC number prediction in MGYG000000098_01366.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	57	364	2.1e-76	0.9548192771084337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.92e-48	59	360	29	335	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.66e-42	31	358	14	347	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA52191.1	2.83e-229	1	367	1	367
QUT73021.1	2.83e-229	1	367	1	367
QUT40870.1	2.83e-229	1	367	1	367
ALJ39814.1	2.32e-228	1	367	1	367
QDH53377.1	4.27e-224	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.99e-36	162	359	199	405	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.23e-31	53	364	36	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.59e-31	53	364	26	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	5.46e-23	163	312	141	304	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
5NOA_A	1.80e-22	163	315	158	324	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.22e-30	53	364	36	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	5.37e-20	163	328	201	378	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	9.89e-20	124	325	129	339	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.56e-18	116	325	123	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P0A3U6	3.53e-09	215	358	61	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000202	0.999184	0.000161	0.000147	0.000139	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_01366.