CAZyme Information: MGYG000000098_01525

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01525
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		59831.47	5.1596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 26035; End: 27609 Strand: +

Full Sequence      

MKTIYKLFIISLFTLNVFPSCGDENKKDVEITDPVSGNISPVASFSVESTSNENELLVKW
TNSNNQDLDMVEISYKEVAVNVSDRAFTPGHVLLPAQSGKKDEYLLKVPYFATYDVAIVA
INKAGKRSVAKSRTMAPYHKNEEEPGIKLPAMLDRAHSYMTSVIALYFGKSSRSCWRGDY
PYNGGAYWDGDALVWGQGSGLSAFVAMREATKGSEIENEYKSMDEKMFTGIQYFCQMDHN
ILAYSVYPAPGNDRFYDDNVWIGLDMIDWYIETNEVRYLTQAKVVWNYLKDHGWDETCGG
GIHWKELNEPSTSKHSCSTGPAAVLGCKMYLATHEQEYLDWAIKYYDYVINVLQDKSDHL
FFDNVRPNTENPNLPGDIEKNKYSYNSGQPLQAACLLYKITGEQKYLDEAYAIAKSCHKK
WFMPYRSKELNLSFNILSPGHAWFNTIMCRGFFELYSIDNDRKYIDDIEKSLLHAWSSSC
HQSNNLLNDEDLRGGISMDSWQILMQGALVELYARLAVLERENR

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	159	486	2.5e-69	0.8659217877094972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.24e-47	154	424	4	257	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.87e-15	254	420	90	247	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
COG1331	YyaL	2.47e-04	257	441	405	592	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
COG4225	YesR	0.007	328	468	47	160	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69502.1	0.0	1	524	1	525
BCA48349.1	9.64e-318	1	524	1	525
QMW86161.1	9.64e-318	1	524	1	525
AAO78897.1	9.64e-318	1	524	1	525
QUT41669.1	9.64e-318	1	524	1	525

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	1.06e-249	152	524	3	375	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	5.65e-183	39	520	24	495	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4MU9_A	2.12e-47	156	516	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4V1S_A	6.40e-23	241	465	124	336	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4V1R_A	3.85e-22	241	465	124	336	Structureof a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1R_B Structure of a selenomethionine derivative of the GH76 alpha- mannanase BT2949 Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000218	0.045645	0.954079	0.000028	0.000034	0.000028

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_01525.