CAZyme Information: MGYG000000098_01651

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_01651
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688		77800.43	6.2112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 21723; End: 23789 Strand: +

Full Sequence      

MIKKNRRLKVRFAGVLLTASLLTTACATSSTGDVVKVVDRPDTQLANVNYVSYRAPLQPL
NFIKLPVGSVQPEGWVKKYLELQREGLTGHLGEISAWLEKENNAWLTTGGDHGWEEVPYW
LKGYGNLAYILNDPKMIAETKVWLEGVFASQQPDGYFGPVNERNGKRELWAQMIMLWCLQ
SYYEYSNDQRVIDLMTNYFKWQMTVPDDMLLKDYWENSRGGDNIISIYWLYNRTGDKFLL
DLAEKIHRNTADWTKSTSLPNWHNVNIAQCFREPATYYMQTGDSAMLKASYNVHNLIRRT
FGQVPGGMFGADENARMGYIDPRQGVETCGLVEQMASDEIMLCMTGDPMWAEHCEEVAFN
SYPAAVMPDFKALRYITCPNHAISDSKNHHPGIDNSGPFLSMNPFSSRCCQHNHAQGWPY
FSEHLVLATPDNGVATAIYGACKATVKVGQGKEIVLHEQTNYPFEEGITFTVSTGEKVAF
PFYLRIPSWTSDAEVRVNGKKVSAKPVAGKYLCIEREWADGDKVELTLPMSLSMRTWQVN
KNSVSVDYGPLTMSLKIDENYVEKDSRETAIGDSKWQKGADSKKWPTTEIYANSPWNYSL
VLDQKEPLKNFKVVRKEWPADNFPFTVGSVPLEVKAFGRQIPSWKIDETGICGVLPEEDA
AKGAKEEITLIPMGAARLRISAFPNTRE

Enzyme Prediction     

No EC number prediction in MGYG000000098_01651.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	326	552	3.9e-33	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	7.28e-167	35	552	2	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.55e-25	113	532	57	478	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN08321.1	5.66e-164	16	684	8	664
APS23119.1	1.87e-162	49	684	43	665
QXQ95199.1	3.62e-162	5	684	4	665
QKW18167.1	4.38e-162	50	686	51	670
AWL89945.1	7.42e-162	5	684	4	665

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.32e-16	116	560	78	566	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	3.03e-15	327	556	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.13e-14	116	560	78	566	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000006	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35