CAZyme Information: MGYG000000098_02641

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_02641
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000000098_20|CGC1	79056.11	6.3516

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 60284; End: 62323 Strand: -

Full Sequence      

MITYKVLRLFFLFMSIICYSNLWSSELQPRQQHNHYINNRYPLQRKAFIELPLGSIRAKG
WLQEMLIRQKNGATGHMDELYPQVMGSRNGWLGGDGDQWERGPYWIDGLLPLAYILNDQE
LKNKVQPWVEWALKSQREDGFFGPEKDYPGEQGLQRDNSHDWWPRMVVLKILQQYYSATN
DQRILSFMSRYFQYQLKTLPEKRLGHWSFWAEFRACDNLQAVYWLYNLTGEPFLLDLGKL
IHSQSFSFVDMVQRGDLKRINTIHCVNLAQGIKEPIIYYQQEPDKKYIHTVKEAFKDIRQ
FHGQPQGMYGGDEALHGNCPTQGSELCSAVELMYSLEKMMEITGDIDFADHLERIAFNAL
PTQISDDFMTKQYFQQANQVMISRHRRNFDQEHGGTDLTFGILTGYPCCASNMHQGWPKF
TQNLWYATPDNGLAVMAYSPSEVTAKVGDDCVVTISEDTYYPMDDKISFTIQEIKNKKKE
TTFPLYLRIPKWCKKAEICINGKPDQSAEGGKMVIINRTWAKEDRIDLHLPMDISTSTWY
ENAVAIERGPLVYALKMEEKWEKKEFNEPWYGPYYYQVTSSEPWNYGLISFDRNKVNEVA
KINIDPAKQKSEFPWNTENAPIEIKMKARIIPTWQLYNEMAGPQPFSFCSGAEGTEKEIT
LIPYGCTTLRISEFPIVGK

Enzyme Prediction     

No EC number prediction in MGYG000000098_02641.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	324	554	2.6e-36	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.15e-60	104	554	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.49e-29	118	555	84	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	8.50e-165	16	678	8	652
QNK64903.1	1.10e-164	36	678	22	646
AMP98056.1	2.58e-163	27	678	19	652
ALL07583.1	2.86e-162	31	678	23	652
ACU60445.1	9.02e-157	22	678	16	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	4.06e-19	293	556	358	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	1.39e-17	105	556	82	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.80e-15	105	556	82	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	1.29e-11	321	554	333	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6EX6_A	1.94e-08	325	567	315	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	7.35e-07	321	556	334	568	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.092995	0.903573	0.002543	0.000287	0.000275	0.000307

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_02641.