CAZyme Information: MGYG000000098_03144

Basic Information

• Species: Bacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000098_03144
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
824	MGYG000000098_28|CGC1	93375.15	5.3836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000098	4868436	Isolate	Canada	North America

• Gene Location: Start: 2526; End: 5000 Strand: +

Full Sequence      

MEKKLLKWMYWGILLLFASCASMVKKESAEILQSVPFHRVHLEDNFWLPRLKTQKEILVP
FALEKTRPAMDNLRKTGNFLRGIKDELPFPHRFIASDLYKVMEGAAYLLILEKDSMLEHT
MDSIIDLIGDAQQEDGYLYESHTTGVAAQHKDEMGEKPYSWVVHSHELYNMGHMYEGAVA
YYQATGKDKWLNIAKKNARHINHVFFEGDPNYNNGKPINQAPGHEEIELALVKLFQATND
SLYLQMAKKFIDIRGVTYKPEGEGVMSPDYAQQHLPVREQTKAVGHSVRATYLYAGMADV
LAQTGDETLKPALDSIWANIVDTRMHITGGLGAIHGIEGFGPEYVLPNKEAYNETCAAVG
NVMFNYRMFMAEKDAKYIDVAEVALYNNVLAGVNLEGNKFFYVNPLEANGTKGFNQGRKG
RSPWFDCACCPSNIARLIPQIAGMMYAHTSDDIYCTLYAGTSTTVPLSTGKVDIKQETNY
PFDESVRFEISPERDGQTFAVHFRIPTWVTSQFVPGKLYSYLNNENADWELILNDKKVSA
QIEKGFVTINRDWKKGDRIELKLPMPVRYNTAIHEVEADLDRVCITRGPLVYCAEAIDNA
ALVSSYVVNASEKETVRKETEGVLKNIDLVTIPATSVSDSNIQQLTLVPYYAWDNRGDDA
MIVWFPQTEDLARASVPVISEYISKVNASHTFELDNMYAMVANKYPDSSSDTSIERWTSW
PEKGKSQWVELKLKAPLNLQSLSVYWYDDNGGVQIPKSWKLEYKSDGKWNDFPLYVTDEY
EVQKNQYNMVHPGKPIITDALRLQIQPKPDAAVGILSIDIEEVK

Enzyme Prediction     

No EC number prediction in MGYG000000098_03144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	40	593	3.6e-181	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.78e-154	40	593	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.15e-144	93	664	63	584	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	3.19e-05	178	280	419	526	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
pfam00754	F5_F8_type_C	2.28e-04	707	806	19	113	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD19473.1	0.0	27	824	22	824
AIA99612.1	0.0	12	821	7	827
QQE10001.1	1.22e-312	35	821	45	844
QWG09265.1	1.60e-304	35	820	44	844
QJE94520.1	1.71e-303	19	821	17	819

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	5.17e-159	32	666	7	624	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.56e-124	40	664	16	644	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.15e-119	40	664	16	644	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.03e-93	93	666	98	695	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
3WRE_A	3.21e-88	93	656	73	647	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.76e-87	93	656	73	647	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000098_03144.