CAZyme Information: MGYG000000100_00232

Basic Information

• Species: CABIZH01 sp902363205
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Massilibacillaceae; CABIZH01; CABIZH01 sp902363205
• CAZyme ID: MGYG000000100_00232
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274	MGYG000000100_1|CGC3	29912.57	6.1537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000100	2685351	Isolate	Canada	North America

• Gene Location: Start: 247647; End: 248471 Strand: -

Full Sequence      

MQYQTTIAKNATYTGIGLHSGCEVTVTIKPAPANTGIVFVRVDLPGCPHVAAISDNVTAT
MRATTLENGEAKVFTVEHLLAACNAMQLDNCYIEMNAPEPPVADGSAIVFVNLIKDVGLV
EQEAKRQVIVIDKVYTAREKDKFITVIPYDGFRISFTSVNPHPMLGVQYCDIEINAETFT
KEIAPARTIAFTKEIEALQKMGLGLGGSIENVIVYDEVKALNPLRYEDELVRHKVLDVVG
DMRLAGNIRGHIIAVKSSHALNTSLARKIKGFVE

Enzyme Prediction     

No EC number prediction in MGYG000000100_00232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	4	269	1.6e-100	0.988929889298893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	4.46e-145	4	269	1	269	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	5.62e-139	1	269	1	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	2.15e-118	1	269	1	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	8.29e-106	1	270	2	299	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	1.45e-94	4	269	3	271	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF53768.1	3.04e-126	3	269	2	268
AJQ25959.1	9.98e-126	4	269	3	268
QJW48361.1	5.18e-125	1	269	1	269
QDR82072.1	1.91e-118	1	269	1	270
SNU94334.1	7.34e-116	1	269	1	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U39_A	3.62e-72	4	269	6	276	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	3.84e-72	4	269	4	274	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	4.08e-72	4	269	4	274	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	4.61e-72	4	269	4	274	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
6MO4_A	4.61e-72	4	269	8	278	Co-Crystalstructure of P. aeruginosa LpxC-50067 complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q88N71	1.11e-72	4	269	4	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=lpxC PE=3 SV=1
B0KFS0	1.11e-72	4	269	4	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=lpxC PE=3 SV=1
A5W8P4	1.11e-72	4	269	4	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1) OX=351746 GN=lpxC PE=3 SV=1
A4XQT0	1.11e-72	4	269	4	274	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Pseudomonas mendocina (strain ymp) OX=399739 GN=lpxC PE=3 SV=1
A7H914	1.62e-72	4	269	6	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999988	0.000061	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000100_00232.