CAZyme Information: MGYG000000100_01197

Basic Information

• Species: CABIZH01 sp902363205
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Massilibacillaceae; CABIZH01; CABIZH01 sp902363205
• CAZyme ID: MGYG000000100_01197
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
522	MGYG000000100_3|CGC1	59790.88	8.8297

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000100	2685351	Isolate	Canada	North America

• Gene Location: Start: 234635; End: 236203 Strand: -

Full Sequence      

MSTNKNISIGIMIIIAAITIFSNLSGFPLLDPDEPVYAETPKEMILSNDFLSPKIYGEYW
YDKPPMYYWLVAMSYQVFGINDFAARFPSAFLSLLSIIAIYFYGKKLFNHKVGIYSALIL
VTSIEFFYLGKAAVTDITLNFCLMVSLFAFLSRQYYTFYIFAGLAVLTKGPIGLFFPGVI
VFLYLVCLKKFHLLSEMKILSGSIIFCLVALPWYIYMYSLHGSAFIDSFLGFHNITRFTS
PEHPSGLLWYYYLPVLLVGFFPWITLLFQSIYKSFSDSYGKFDHLLFLNLWAVIILLFFS
ISKTKLVSYILPMFPALAMLVGWYLDKLTGRNYFGSKRSWGWIGCLLFLSATFVYGCTIG
IKEMPQAEIGFISLASTIILMCLVTIFFLLKRNIEIAFKSQVVGMMIFSAVLVNLLFPKI
APDFTSQHVSNVFLEQYDGTSDVYISKFLRPGISFYSGIYGNELVFSPKSIPDLEKVFTN
KKTYFILRDIDYDRLPQSTINQLTIINQIDNKLILVETRFIK

Enzyme Prediction     

No EC number prediction in MGYG000000100_01197.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	5	426	7.4e-116	0.8111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	5.53e-62	21	423	22	433	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	2.96e-41	24	351	23	359	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.80e-22	62	216	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	7.29e-11	37	218	35	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	9.34e-07	62	413	86	411	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIF51770.1	6.22e-190	14	517	14	511
BBB93297.1	1.38e-181	11	517	11	512
AJQ27709.1	4.21e-178	14	517	14	512
BBB92576.1	1.87e-154	3	516	2	513
AIF49718.1	5.78e-148	7	516	8	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	3.02e-36	11	341	36	373	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.09e-34	11	355	7	351	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	5.61e-31	20	327	17	309	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
C5BDQ8	1.97e-30	24	332	22	339	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A4SQX1	5.22e-29	28	321	24	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	1.28e-28	28	321	24	326	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.956236	0.043173	0.000224	0.000134	0.000105	0.000146

TMHMM  Annotations     

start	end
7	29
83	105
112	129
133	152
159	181
204	226
247	269
284	301
306	324
339	361
368	390
400	417