CAZyme Information: MGYG000000100_01983

Basic Information

• Species: CABIZH01 sp902363205
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Massilibacillaceae; CABIZH01; CABIZH01 sp902363205
• CAZyme ID: MGYG000000100_01983
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203		24131	8.7647

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000100	2685351	Isolate	Canada	North America

• Gene Location: Start: 259039; End: 259650 Strand: +

Full Sequence      

MLRYQEKSGVMRLSSYKKIKWQAFLGILVCFSFICYAIFQSAWFQKKVFYPYPYRELVID
YAVEKKLDPFLVAGVILSESKFNFQARSHKGAMGLMQLMPETAKWIAQQMEDEDFTLAEL
EDPEINIRFGTWYLSSLHKEFEGNEVLMLAAYNAGRGNVKEWMEKYQWDMSFQDVKQIPF
KETREYVTKVLKSKNKYKSLYQE

Enzyme Prediction     

No EC number prediction in MGYG000000100_01983.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	197	2.1e-30	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.44e-83	51	196	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.16e-64	50	200	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	3.88e-44	69	192	1	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	5.21e-40	3	201	75	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	8.24e-31	67	168	10	108	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJW46656.1	3.76e-80	36	201	22	187
QJW46652.1	3.76e-80	36	201	22	187
AJQ28099.1	7.57e-80	28	201	14	187
AIF51128.1	2.51e-78	25	201	11	187
QDR80996.1	7.42e-73	25	201	12	187

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.26e-24	53	201	415	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	1.27e-24	53	201	419	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	1.28e-24	53	201	425	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.29e-24	53	201	429	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.30e-24	53	201	435	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.03e-17	50	191	476	619	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	1.03e-17	50	191	476	619	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.03e-17	50	191	476	619	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
O31976	3.07e-17	54	196	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.07e-17	54	196	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43