CAZyme Information: MGYG000000102_01189

Basic Information

• Species: Terrisporobacter sp902363255
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Terrisporobacter; Terrisporobacter sp902363255
• CAZyme ID: MGYG000000102_01189
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000000102_2|CGC6	55234.9	5.271

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000102	3838773	Isolate	Canada	North America

• Gene Location: Start: 484481; End: 485932 Strand: +

Full Sequence      

MAFKDGFLWGGAVAANQLEGAFNEGGKGWSVADIATYKPNVDVKDYKKHVSVSLDAIKEA
MQDTDNTYYPKRRGIDFYHNYKEDLALFAEIGFKVLRISIAWTRLFPTGEELEPNKEGIE
FYRNLLQEMKKLGIEPLVTLSHYEMPLELALKYNGWTDRRVIDMFTRFCKTCFEEFGEYV
KLWLNFNEVDSIIRHPFTTGGLIPELCNGEELKCCYQALHHQFVASAIATKMCHEIIPGS
QIGCMLTKLMTYPRTCAPADVLATQSKNLDNHFYSDVMVFGEYPRLKTVELKKLGYYPQM
EEGDLEIIKEGTVDFVSFSYYMSMTESVDPNAERTPGNTVLGVRNPYLESSDWGWQVDPV
GLRISLIELYDRYKKPLFIVENGIGAKDIIGEDGSIHDPYRIAYFKSHFEQMKKAVEDGV
ELMGYTSWAPIDLISASTSQITKRYGFIHVDQDDLGNGSGKRRRKDSFYWYQNVIKTNGA
NLD

Enzyme Prediction     

No EC number prediction in MGYG000000102_01189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	479	1.4e-138	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	482	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	483	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	1	479	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	483	4	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.66e-171	7	482	10	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM68785.1	5.96e-269	1	482	1	483
AIF67468.1	8.03e-253	1	483	1	484
AMQ98678.1	1.32e-252	2	482	6	486
APE41812.1	1.32e-252	2	482	6	486
QPQ19863.1	1.32e-252	2	482	6	486

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.41e-186	3	482	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.21e-159	3	482	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	1.31e-159	7	482	12	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.83e-149	5	482	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
3QOM_A	3.80e-149	2	483	10	481	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.36e-181	3	482	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	4.66e-171	3	483	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P11988	1.14e-160	2	482	3	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
P26206	2.22e-159	3	482	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
Q46829	7.17e-159	7	482	12	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000102_01189.