CAZyme Information: MGYG000000103_03443

Basic Information

• Species: Bacilliculturomica massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Bacilliculturomica; Bacilliculturomica massiliensis
• CAZyme ID: MGYG000000103_03443
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773	MGYG000000103_18|CGC1	88212.31	7.4823

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000103	4467403	Isolate	Canada	North America

• Gene Location: Start: 27494; End: 29815 Strand: +

Full Sequence      

MDRKAKSNTKNSKSGRELAWIYIAVLSMTVYVVWRIFFTIPEHQIYGWFATVCGMLLVVS
ETISMLEGSEHFFRLRKKNMPEKPEVPLSWFPHIDILIATHNEETELLYKTVNGCKHMDY
PDKGRVHIYICDDGNRPEMAKLAAEMGVGYCTLEENRDAKAGNLNNAIQMTGSPWIVTFD
ADMIPTHDFLMETVPYTFLPRMKQLEDGSWRERTEEERDEDYRIGFIQTPQSFYNPDLFQ
FNFFSEQRIPNEQDFFFREINVGRNSANASIYAGSNTLISRQALEDVGGIATGTITEDFE
TGILIQAKGYTCYAFDQPLAHGLAPTDVDSLIRQRRRWGRGCISSLRRVRILRNPNLKLN
TKLSYISCLLYWWTFARRFVYIVCPILFVLFGIPVVICGLPELVLIWLPSYLLYNHALKV
TSGRLRTQRWSNIVDTTIFPYMILPILMETLFIQQKKFDVTNKTRTVGKKSDLPLAAPHM
ILLLLDAAALLISVRSAVLNNNFGAAIIIYWLAVNGLNLVMAVFFMVGRRNLRANDRFRI
SVPVEVHYRGTSYYGETADLSETGLSLMTQKAIYLPDGNDTVGIHLKSERYETRFKARTV
QVAKRDGGWQYGLEIVELEGKNKDEYYQMLYDHHHSLADQIHRSVSVFEDVFINIHRRAQ
SGRTSNRKLPRVDLDLDLETGSGTPVRAVNCNYKYILLTGAGEGQRELELLIPGCSARMR
CVRPADGNPKAGLFAVVNWEELLFEGAYEKLFAAAEDAAAQRAEEAGKDGRPS

Enzyme Prediction     

No EC number prediction in MGYG000000103_03443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	175	402	3.4e-22	0.9187817258883249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	7.43e-89	92	346	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	1.03e-61	25	628	191	774	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	3.54e-48	23	481	1	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	3.47e-27	101	348	7	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
pfam13632	Glyco_trans_2_3	5.99e-22	175	408	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL34255.1	1.42e-243	20	672	11	665
QJA08945.1	3.62e-225	21	674	13	660
AEF82376.1	2.75e-214	6	674	17	683
QOX64858.1	1.26e-208	24	674	15	663
SMF90406.1	1.14e-198	16	674	6	666

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.48e-55	20	570	55	608	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.94e-55	21	628	200	787	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
4HG6_A	3.48e-55	20	570	67	620	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	3.52e-55	20	570	68	621	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WX75	5.70e-59	11	572	64	611	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	5.70e-59	11	572	64	611	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1
Q9WX61	1.21e-58	21	619	76	661	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
Q59167	6.18e-58	22	573	75	615	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
P58931	2.25e-56	18	600	86	649	Cellulose synthase catalytic subunit [UDP-forming] OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39
44	66
386	408
431	453
473	495
505	527