CAZyme Information: MGYG000000104_00237

Basic Information

• Species: Clostridium cuniculi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium cuniculi
• CAZyme ID: MGYG000000104_00237
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	MGYG000000104_1|CGC8	44631.99	5.2273

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000104	3679160	Isolate	Canada	North America

• Gene Location: Start: 291611; End: 292765 Strand: -

Full Sequence      

MIKYLKKINYLRKQNLYKNYINSILDVVDFTPIVNEMPDKVKTITFVIPGMPAYSGGHTS
ILRLGSELSKSGYIVNYVSFTPQSIEDMKKNAVINLENYKGKFMQYTENDMKSDVVIATS
WDSVYFARKMNGYKMYFVQDYEPYFHLYGECYLMAKKTYELGFHIVSLGKWNKYMIENEC
DTNSIVDYITFPYEGGEYYDKGRDFDAYKDKREFNMAVYIKDTGKRAPYLIQYLLKRLKE
DFEKEDLKLNINYFGESTDFKCDAGENLGKMGKKELLELYSSSDFGMVGSLTNISLVPYE
MLATGLPIIEFKEGTFNYFFPDNSAIVTSFDYNELYSKVKAAIEDPNILKEINKTAKDYL
STLSWSETGNEFNDILKKITNKEV

Enzyme Prediction     

No EC number prediction in MGYG000000104_00237.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0438	RfaB	6.93e-09	44	383	4	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	1.18e-06	44	377	2	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
PLN02871	PLN02871	0.007	268	365	317	420	UDP-sulfoquinovose:DAG sulfoquinovosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLY79141.1	1.61e-143	18	379	21	385
QHQ63593.1	1.15e-141	18	376	16	375
BCJ97627.1	9.24e-135	18	384	26	393
BCJ96280.1	1.62e-131	18	379	26	388
ANP70838.1	1.28e-129	17	384	14	382

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000104_00237.