CAZyme Information: MGYG000000104_02579

Basic Information

• Species: Clostridium cuniculi
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium cuniculi
• CAZyme ID: MGYG000000104_02579
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000000104_18|CGC2	81612.18	4.5827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000104	3679160	Isolate	Canada	North America

• Gene Location: Start: 67433; End: 69499 Strand: +

Full Sequence      

MRREYINYPFDLPIKISYLNIKNYPTHWHNSIEIIYVLKGSLHIKIDTDSFTLNEREVEI
INSDESHEIQGMDDNKVLIFNIDPFFFEKYYKDINNIFFYTNSNDDEDQNGPEYEELKTI
LSQMLCEYVQKLEDYDEEIEELLITLLYHLVNNFHYLTHEKEELKEKTDQLARYHRISKY
IYNNYNNNITLQEIAKKEFLSPHYLSHEIKYATGYSFTDLINLTRIEESIKLLLDSDMSI
SEISDEIGFSHVRYFNKNFKYYYGCTPLQYRKKYATTEKEYDLSKQFEELSLNDALETLS
YSLENYNRFNFENKLWNIHVDVDKILNPLEKDFKECINLGESFDLLIEDNKDILEEIQEE
IHFEYGRLEKMFHSDMGVFLDSDFYNWNKAKGVLEFLSNIYLKPLILLDNLDYSLEKYIN
ILSSFLDYFTELDIVEVADFKFQFDSRLSEDIKDNLRQYIKDYYELEVCEIDFTSKSDLN
SIYDTAYMLPYIIHNTIFKGNSLSFLKAFDVLEKEINITNEVFIGAPGIVNDMGIRKPSY
YAYYLLSKLGNDIIALDDGYIVTKSDNYYAILLYSHNDDVNTLVSYEDIYQKGGVKKSFE
RKYSLNIVNIKNSTRIITYEVNESIGSSYNYWLAMGSPDRLSKEEKEILHKASYPKIEFK
YSKKSSVLNIITELKGYGAKLIVLKNIK

Enzyme Prediction     

No EC number prediction in MGYG000000104_02579.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	472	641	9.1e-19	0.37587006960556846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00342	HTH_ARAC	1.12e-22	190	271	3	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	2.26e-20	194	273	1	81	Helix-turn-helix domain.
COG2207	AraC	2.45e-20	190	274	38	122	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
COG4753	YesN	4.14e-12	87	275	283	475	Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription].
PRK10371	PRK10371	2.16e-08	190	272	209	291	transcriptional regulator MelR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATD56640.1	0.0	1	688	1	689
QBJ75981.1	0.0	1	688	1	689
SLK21057.1	0.0	1	688	1	689
ATD55683.1	0.0	1	688	1	689
AYE35030.1	0.0	1	688	1	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3LSG_A	7.78e-10	190	272	21	103	Thecrystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_B The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_C The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_D The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum],3LSG_E The crystal structure of the C-terminal domain of the two-component response regulator yesN from Fusobacterium nucleatum subsp. nucleatum ATCC 25586 [Fusobacterium nucleatum subsp. nucleatum]
4M29_A	3.50e-07	474	649	283	460	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	4.62e-07	474	649	283	460	ChainA, Beta-xylosidase [Caulobacter vibrioides]
6YYH_A	8.30e-07	501	657	333	474	Crystalstructure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYH_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum in ligand-free form [Dictyoglomus thermophilum H-6-12],6YYI_A Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12],6YYI_B Crystal structure of beta-D-xylosidase from Dictyoglomus thermophilum bound to beta-D-xylopyranose [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HJR8	1.75e-14	30	658	21	713	Uncharacterized HTH-type transcriptional regulator SACOL0084 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL0084 PE=4 SV=2
Q6GKK1	3.05e-14	30	658	21	713	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1
Q8NYT6	1.60e-13	30	658	21	713	Uncharacterized HTH-type transcriptional regulator MW0077 OS=Staphylococcus aureus (strain MW2) OX=196620 GN=MW0077 PE=4 SV=1
Q6GD21	1.60e-13	30	658	21	713	Uncharacterized HTH-type transcriptional regulator SAS0078 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=SAS0078 PE=4 SV=1
Q99XB1	2.78e-13	30	312	21	300	Uncharacterized HTH-type transcriptional regulator SAV0101 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0101 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000104_02579.