CAZyme Information: MGYG000000105_01834

Basic Information

• Species: Bacteroides clarus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides clarus
• CAZyme ID: MGYG000000105_01834
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535	MGYG000000105_3|CGC10	58880.02	4.495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000105	3966085	Isolate	Canada	North America

• Gene Location: Start: 402065; End: 403672 Strand: +

Full Sequence      

MKIKYLLSCSLLAGSALFASCTSIEPKLDNDYKPLLPEEIPEGTITQLNYGELRAFPGAE
GHGRDVTGGRGGKVYHVTSLEDGGDGDQGTFRWAVRQSGARTIVFDVAGTIHLKKALKIE
ADNITIAGQTSPGGICIADQAFTIAANNVIIRFMRFRPGNPADDVDGLGGMDRKNIIVDH
CSVSWSSDETLSVYGMENSTVQWCIASQALYFTQAKDGKAHGFAGNWGGHNATYHHNLIA
HCDSRTPRLGPRPSTLELGEQVDIRNNVFYNWGGEGCYGGETQHANLVNNYYKPGPTTDL
LKDRRCYRIARIGIYGQNYDNGEGFEPFKGIWGRFYIDGNYMFGNADVTADNWTDGVYAQ
QEDNDGNDYTWESEGKSVINNGSQVVDVKGVTTHTAETAYDQVLKYVGACNYRDTYDKFI
MDEVAERKATCNIQGSNHKLGYINHPSELVGIVEGVDENGYPVLVQVADNDLTDTDGDGI
PDYWETQYGLNKDYAADGNLKTVDENGEYTNLEMYLNSLVQDIMDKCREGGTVVE

Enzyme Prediction     

No EC number prediction in MGYG000000105_01834.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	108	292	1.1e-71	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	3.29e-08	102	274	3	168	Amb_all domain.
COG3866	PelB	4.11e-08	67	249	49	236	Pectate lyase [Carbohydrate transport and metabolism].
pfam00544	Pec_lyase_C	0.005	146	271	59	190	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ55766.1	4.40e-201	15	535	17	553
SCV08374.1	4.40e-201	15	535	17	553
ALJ48956.1	4.40e-201	15	535	17	553
QGT73502.1	6.24e-201	15	535	17	553
QUT78077.1	1.25e-200	15	535	17	553

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	3.55e-07	60	272	46	251	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B297	3.08e-40	53	522	20	413	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
B8NQQ7	7.38e-39	53	520	20	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	4.71e-37	53	520	20	414	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
Q0CLG7	6.00e-36	53	520	20	414	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
A1DPF0	1.15e-35	53	520	21	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000052	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000105_01834.