CAZyme Information: MGYG000000105_02259

Basic Information

• Species: Bacteroides clarus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides clarus
• CAZyme ID: MGYG000000105_02259
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000000105_4|CGC5	36252.51	8.3037

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000105	3966085	Isolate	Canada	North America

• Gene Location: Start: 256309; End: 257274 Strand: +

Full Sequence      

MKVTVKTLCCFVMTLLCGIGSLSAAQQWKDTIVVARDGTGDYRTLTEAMEGIRAFMDYKV
TVLVKKGVYKEKVVLPSWLENVDFIGENVENTIITYDDHANINKMGTFRTYTLKVEGSSI
TFRNLTIENNAARLGQAVALHTEGDRLVFINCRFLGNQDTVYTGAKGTRLYFLNCYIEGT
TDFIFGPSTALFKDCIIHSKSNSYITAASTPKEIEVGYVFKNCRLTAAPGVDKVYLGRPW
RPYAATVFINCELGRHICPAGWNNWRNPENEKTARYAEFGNTGEGADDTNRVKWIKRLTQ
KDVAKYEDMSYLFKICSEWKP

Enzyme Prediction     

No EC number prediction in MGYG000000105_02259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	32	311	2e-99	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	8.41e-77	34	306	9	290	pectinesterase
pfam01095	Pectinesterase	1.80e-74	32	304	2	286	Pectinesterase.
PLN02432	PLN02432	1.09e-65	32	306	13	280	putative pectinesterase
PLN02708	PLN02708	9.16e-64	34	321	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02682	PLN02682	2.41e-63	31	319	70	366	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48638.1	4.56e-192	1	320	1	320
QUT45769.1	1.32e-190	6	320	2	316
QDO69178.1	7.52e-179	10	321	9	320
ALJ61263.1	1.31e-172	10	321	9	320
QUT93208.1	1.31e-172	10	321	9	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	5.35e-36	32	294	9	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	1.96e-35	33	294	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	8.22e-27	32	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.23e-26	32	291	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	1.28e-45	29	312	255	551	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	1.52e-45	34	312	9	296	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
P41510	1.59e-45	29	296	270	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q4PSQ5	2.43e-45	6	312	10	321	Probable pectinesterase 66 OS=Arabidopsis thaliana OX=3702 GN=PME66 PE=2 SV=2
Q9FM79	9.38e-45	25	313	75	373	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005482	0.910395	0.083199	0.000299	0.000281	0.000301

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000105_02259.