CAZyme Information: MGYG000000105_02266

Basic Information

• Species: Bacteroides clarus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides clarus
• CAZyme ID: MGYG000000105_02266
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000000105_4|CGC5	41761.44	7.4476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000105	3966085	Isolate	Canada	North America

• Gene Location: Start: 266867; End: 267958 Strand: -

Full Sequence      

MKLKIFLIGILFPAAVFAQKAPSLDALQDGIHHWNLLHPDRTYARYAEKDYEKIADNLIA
YQNEDGGWLKNMDWAGVLNIDSIKAGLKDGQKRSTLDNRNTFSQIEYLADVYTLTKKQKY
RAASEKGLRYLLSTQKDNGGWRGWDVDAVTFNDDVTTGTLELFRNILQGDSSFLWLDSGM
LNAIQKSYDKGLAVVLKTQYVQNGVKTAWAQQYDNETLVPVKARTFELPGLTAWESTAIT
IFLMGIKNPSEEVIQAIEAAIAWFNNSKIEGIRIERVPLQGKDIINHEYPYDNVVVKDET
APAIWSRFYELSDNRPFMAKRSGEKVWKLSDVNAERRTGYDWYGYWPVEALKMYKEWKKQ
FKH

Enzyme Prediction     

No EC number prediction in MGYG000000105_02266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	62	348	5.4e-94	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	9.44e-91	62	347	1	285	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	4.77e-88	62	351	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37157.1	1.43e-153	2	357	5	360
QDU41600.1	2.68e-108	23	358	50	387
QDT46035.1	1.08e-107	23	358	50	387
QDU80650.1	1.06e-103	23	360	47	386
AOW11429.1	2.05e-90	7	361	15	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	4.84e-52	40	360	72	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	4.55e-39	55	351	37	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	6.56e-38	55	351	37	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000274	0.999036	0.000172	0.000164	0.000161	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000105_02266.