CAZyme Information: MGYG000000106_00316

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_00316
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000000106_1|CGC8	40150.16	4.5317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 341216; End: 342259 Strand: +

Full Sequence      

MTDFNKYADLAQTSIDYFYQAASKEQFMNNVYPLRDEKENETFNYWWIAHLVDVRIDAYL
RTNDTAYLQQAEETYHYNKARNNNTLLHEFYDDMLWNALAGLRLYDLTKKKEYLADAREV
CLDIFDTAWNDHMNGGFAWKRTQLDYKNTPVNAPIIILALRLYQVEANERYLTTSQQTLE
WMKKYLVQPDTQFVEDGINRNGDGKIDVQWKFTYNQGVYIGALIEFYHVTDDISYLKDAI
TCAKTSFEVIGKDGVFNDEGDGGDIGLFKGIEYRYLNLLVKEAEKVGLDIASIKGFVTSS
CERLLEHSQKEGHLLAYRDWLVAEIPTSVFLSDQLSGVMALESAAII

Enzyme Prediction     

No EC number prediction in MGYG000000106_00316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	20	321	9.3e-75	0.8463687150837989

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.74e-92	6	345	5	350	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	8.81e-26	44	276	33	288	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG1331	YyaL	0.006	30	180	399	565	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04434	LanC_like	0.006	54	290	60	298	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT90634.1	3.84e-258	1	347	1	347
QGR82046.1	5.45e-258	1	347	1	347
QOG28286.1	7.74e-258	1	347	1	347
EEV40360.1	2.53e-202	1	347	1	347
ASV95817.1	6.83e-177	1	345	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K7X_A	6.99e-115	4	345	3	338	ChainA, Lin0763 protein [Listeria innocua]
6SHD_A	6.41e-50	35	347	78	389	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.92e-48	35	347	79	390	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	1.45e-47	35	347	79	390	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
4BOK_A	4.13e-28	35	287	28	283	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000106_00316.