CAZyme Information: MGYG000000106_00340

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_00340
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199	MGYG000000106_1|CGC9	21081.73	4.0484

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 374269; End: 374868 Strand: +

Full Sequence      

MKSLKTVLLSTAVLAGLGVFLGGQDAFADEEYTVQSGDTLSTIAYNYFGTSEAVDKIVEA
NGITNKNLIYVGETLVLPTDDASYTIERSSAAAESSVTYEEPASQPASSQQTSPSSSASS
SSAATGSEASAKEWIANKESGGSYTATNGQYYGRYQLTNSYLNGDYSAANQEKVADNYVA
SRYGSWSAAKAFWEANGWY

Enzyme Prediction     

No EC number prediction in MGYG000000106_00340.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	8.20e-12	32	77	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	8.65e-11	32	78	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
smart00257	LysM	3.92e-10	31	77	1	44	Lysin motif.
PRK11198	PRK11198	4.26e-09	24	78	90	146	LysM domain/BON superfamily protein; Provisional
NF033598	elast_bind_EbpS	1.49e-06	33	78	420	466	elastin-binding protein EbpS. The elastin-binding protein EbpS is an adhesin described in Staphylococcus aureus, with orthologs found in many additional staphylococcal species. EbpS is a membrane protein that lacks an N-terminal signal peptide region, has extensive regions low-complexity sequence rich in Asn and Gln, and has a C-terminal LysM domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY08672.1	2.02e-104	1	199	1	199
QOG28265.1	2.35e-103	1	199	1	199
QGR82027.1	2.35e-103	1	199	1	199
QCT90616.1	2.35e-103	1	199	1	199
AMG48494.1	1.10e-67	1	199	1	205

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000280	0.998997	0.000203	0.000184	0.000170	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000106_00340.