CAZyme Information: MGYG000000106_00355

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_00355
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	MGYG000000106_1|CGC10	33861.12	7.0505

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 387420; End: 388304 Strand: +

Full Sequence      

MIEQIDTGYPIVDFFLFLLVAILFTYPILGGFAWFNGVLCHTYLFKHQQIEWIPIPEEVE
PMITTMVPAHNEEVVIKDTIHYLMNKLNYTRYEVLVTDDGSTDQTPEILKRLQQTYPNLR
VVCIQKNQGKAHAFNIGIGFANGELILSNDADTVPEPDALWKYVNYFIRQDAVNISAITA
NMDVQNRTTIVSKSQTVEFSSIVGIIKRTQQGVLGVIYAYSGANTMYRKNALIDVGLFRQ
NRATEDISIAWDHQFQGWLSLFAPRIMFFMEVPETMKMLYRQRKRWKKAVQKSG

Enzyme Prediction     

No EC number prediction in MGYG000000106_00355.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	66	235	9.7e-32	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	3.57e-77	11	286	2	275	N-glycosyltransferase; Provisional
cd06423	CESA_like	3.09e-55	66	246	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
PRK14583	hmsR	1.41e-53	11	288	22	298	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	5.13e-52	18	286	10	280	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	9.09e-26	67	232	4	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGR82014.1	1.02e-203	1	288	1	288
AYY08657.1	1.02e-203	1	288	1	288
QOG28251.1	3.40e-202	1	288	1	288
QCT90601.1	2.79e-201	1	288	1	288
EEV37891.2	7.05e-172	1	288	1	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	9.41e-13	44	166	19	151	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	9.45e-13	44	166	20	152	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
5EKE_A	3.93e-07	63	165	28	132	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKE_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (F215A mutant) [Synechocystis sp. PCC 6803 substr. Kazusa]
5EKP_A	3.93e-07	63	165	28	132	Structureof the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_B Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_C Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa],5EKP_D Structure of the polyisoprenyl-phosphate glycosyltransferase GtrB (WT) [Synechocystis sp. PCC 6803 substr. Kazusa]
5MLZ_A	5.69e-07	63	164	25	125	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8XAR5	1.56e-43	18	286	29	296	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	2.18e-43	18	286	29	296	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q7A351	1.13e-37	26	286	10	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q6GDD8	1.13e-37	26	286	10	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q5HCN1	1.13e-37	26	286	10	267	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999902	0.000136	0.000001	0.000001	0.000000	0.000002

TMHMM  Annotations     

start	end
13	35