CAZyme Information: MGYG000000106_01750

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_01750
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1102		127227.14	8.6248

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 337470; End: 340778 Strand: -

Full Sequence      

MSAVGNIKLLINKVLNSFVSKNGSIASFYAKLSTIDIKKNTILYEVRDGQSIVDSPFAIF
KYLVNDPDFAHYHHVWVINDLDYPTVNKIKASYKNVDFVVRNSKEYLKWLASAEYLVNNA
TFQSFFVKKKEQIYINTWHGTPLKYMGFDIPGNPAHSQNVVRNFLMADYILSPNAHTTEI
FSKSYRLDGIFPGVILEGGYPRIDCTNSIQREVIKEELGELNLVFDDNLPTILYTPTWKG
SSILNPSNDEEQIIRETYLLKDYFKGKYNVLVKVHPYIYKTLSRNERIKHILIPDSLDPN
EVLSIVDLLITDYSSIFFDFLVTDKPIIFYVWDRDLYEADRGMYLPESVLPGPVAETVDE
LIDLIEKKDIFVDQYRQNYRLMKEKICNYQDGNVTKRYVERIFKKRKSEKIKEILLRNDL
KKLIIYPGGMKNNGITTSFINLSNNIDYSKYDISIILNKPVSSEEIKNLNKINKNVRMLF
RPGNSLFTRNELIRDYFIQLFSLKKGWRFLLPEKAYKREAARIVGNIAFDVAIDFSGYSF
FWAKLIAFMNSNKRIIFQHNDLLSDSKKIINGKAPHKKNLPAVFSIYYLFDRILSVSKET
MEINRKNLKEFITDGQIGYTTNTIDISKIMTSGSVDSSNPNANNQEISNFRFTGNIIAAK
TYQVYTSLSLLEKGVYFSKTITEDDEIYVLASTFYNMKEYAKITVNGIYTGWIEKRFIQA
SNKGIQKEETIIENRSMIATINCSNDEMIYYSMSDLNSIRSPLKYLNNTYAYISKEQKIN
DTSYCYIENSNGEIGWINKNCLSNFHQTFHLKALKNYFLNKNVKEKTIVLDKFQSIFIQG
QFKYKTTIGWTEPVPIAGSEQVAIMFEKDDVALFTKKATINQKDYYCTNSAEGNKIWIEA
KNIEEARVNSMEIQSNLIDERAKNQKRISGPTISSDSINLVNMGRLSPEKNQINLIKAIK
QIIEDQKNVRLYILGEGPLKLEMKQLIKKLELEEHVFLLGHQEDPFSIMKQCDLFVFPSI
YEGQPMVLLEALTLKLPVLATNIPANVSVLGEYSTTYIEGFSAEDIAQAILNRICKLNDT
MRFSPEEYNSAALKSFYREIET

Enzyme Prediction     

No EC number prediction in MGYG000000106_01750.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	940	1072	2.7e-32	0.84375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	5.81e-98	37	404	2	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	7.63e-64	6	406	2	388	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
cd03811	GT4_GT28_WabH-like	2.06e-41	916	1097	166	350	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam00534	Glycos_transf_1	2.35e-32	940	1070	5	138	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
pfam13692	Glyco_trans_1_4	1.09e-30	940	1071	4	133	Glycosyl transferases group 1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGR80926.1	0.0	1	1102	1	1102
QOG27093.1	0.0	1	1101	1	1101
APB31711.1	8.75e-284	9	1101	1	1108
EEV39642.2	4.73e-278	37	1100	38	1113
AUJ85035.1	1.06e-276	37	1100	38	1113

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	3.82e-37	4	395	316	707	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	2.79e-36	4	395	316	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	6.54e-36	4	395	316	707	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
4X6L_A	5.87e-09	942	1102	323	480	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X7M_A	5.87e-09	942	1102	323	480	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8RKI5	3.87e-44	42	402	34	392	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	3.29e-38	5	404	343	744	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	7.21e-38	24	404	13	389	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q5HLM5	1.98e-36	4	395	316	707	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q58459	4.99e-21	933	1042	198	307	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000106_01750.