CAZyme Information: MGYG000000106_02903

Basic Information

• Species: Enterococcus_D gallinarum
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D gallinarum
• CAZyme ID: MGYG000000106_02903
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000000106_10|CGC1	42984.77	4.652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000106	3151412	Isolate	Canada	North America

• Gene Location: Start: 27296; End: 28465 Strand: +

Full Sequence      

MTHLEQVRQSEPNGVMYRDTFLNVDFGLIPTGGNNTAHAPALIETADGGMLCGWFAGSFE
GSGDISIVVSKLDPETQKWSVPVTVSEGIDRSEQNPSFFRAPDGKIWLIYTSQVSRQEGK
DNMQFTSIIMVQKSADEGKTWGKPEVLFDKEGTFGRQGIQILSNGRWLYSTWLCEDSADG
LTNDPTEFQVSDDQGQTWRAVRMPDSNGRVHANVVEVEPGHLVAFMRSRFADFVYSSESF
DFGDRWSVPTATVLPNNNASISAIKLNSGEIALAYNVNAAPNAAFGQVAWPGLRNPVAVS
VSEDFGKTWPIGRIFEAAEGYIGAENKTNNSQHEYPTLYQDSQGNLHLVYAYRNRLCVKY
VRFTVADLFGEKRESVGVYNPTSGEGVEK

Enzyme Prediction     

No EC number prediction in MGYG000000106_02903.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	31	356	3.2e-35	0.9239766081871345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	7.00e-59	48	348	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	1.73e-55	31	364	8	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4692	COG4692	7.13e-34	36	366	32	374	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
COG4409	NanH	3.66e-05	134	368	477	726	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd09000	GH43_SXA-like	0.002	79	169	111	194	Glycosyl hydrolase family 43, such as Selenomonas ruminantium beta-D-xylosidase SXA. This glycosyl hydrolase family 43 (GH43) includes enzymes that have been characterized to mainly have beta-1,4-xylosidase (beta-D-xylosidase;xylan 1,4-beta-xylosidase; EC 3.2.1.37) activity, including Selenomonas ruminantium (Xsa;Sxa;SXA), Bifidobacterium adolescentis ATCC 15703 (XylC;XynB;BAD_0428) and Bacillus sp. KK-1 XylB. They are part of an array of hemicellulases that are involved in the final breakdown of plant cell-wall whereby they degrade xylan. They hydrolyze beta-1,4 glycosidic bonds between two xylose units in short xylooligosaccharides. These are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. These enzymes possess an additional C-terminal beta-sandwich domain that restricts access for substrates to a portion of the active site to form a pocket. The active-site pockets comprise of two subsites, with binding capacity for two monosaccharide moieties and a single route of access for small molecules such as substrate. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOG29234.1	2.88e-282	16	389	1	374
QGR83607.1	3.36e-281	16	389	1	374
QCT93337.1	3.36e-281	16	389	1	374
ASV96651.1	2.23e-270	16	389	1	374
QED60981.1	1.18e-265	16	389	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MYV_A	2.31e-06	122	309	286	472	Sialidase26co-crystallized with DANA-Gc [bacterium],6MYV_B Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_C Sialidase26 co-crystallized with DANA-Gc [bacterium],6MYV_D Sialidase26 co-crystallized with DANA-Gc [bacterium]
6MRV_A	2.37e-06	122	309	307	493	Sialidase26co-crystallized with DANA [bacterium],6MRV_B Sialidase26 co-crystallized with DANA [bacterium],6MRX_A Sialidase26 apo [bacterium],6MRX_B Sialidase26 apo [bacterium],6MRX_C Sialidase26 apo [bacterium],6MRX_D Sialidase26 apo [bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998826	0.001196	0.000004	0.000001	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000106_02903.