CAZyme Information: MGYG000000107_00307

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_00307
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000000107_1|CGC7	43610.59	4.9221

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 362109; End: 363248 Strand: +

Full Sequence      

MKVWPVKHSPLLRQPERFIARNELQALIQKVTQNLVNIKDESGQFLLRLDDGRIIDTKGW
NGWEWTHGVGLYGIWQYYQQTGDIAMRDIIDGWFADRFAEGATTKNVNTMAPFLTLAYRY
EETGNAAYLPWLDSWAEWAMNEMPRTESGGMQHITLAEENHQQMWDDTLMMTVLPLAKIG
KLLNRPEYVEEAVYQFLLHVQNLMDRESGLWFHGWNYEGRYNFARARWARGNSWLTIVIP
DFLELVDLPENSAVRRYLVQVLDTQIAALARCQDDSGLWHTLLDDPDSYLEASATAGFAY
GILKAVRKRYVSQAYTEVAEKAIRGIVANISAQGELLQTSFGTGMGSDLDFYRDIPLTSM
PYGQAMAILCLTEYLRKYF

Enzyme Prediction     

No EC number prediction in MGYG000000107_00307.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	60	376	6e-115	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.95e-138	29	379	2	354	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.26e-123	37	378	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDY53356.1	1.77e-286	1	379	1	379
SQI95190.1	1.77e-286	1	379	1	379
AYZ51041.1	2.52e-286	1	379	1	379
AVL83270.1	3.58e-286	1	379	1	379
AKL26233.1	5.09e-286	1	379	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	6.78e-252	2	379	5	382	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	2.48e-240	3	379	5	381	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	3.57e-156	23	378	7	372	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3K11_A	4.77e-20	187	357	224	392	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	4.73e-51	63	376	29	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P0A3U6	3.36e-10	180	339	10	169	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.36e-10	180	339	10	169	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_00307.