CAZyme Information: MGYG000000107_00405

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_00405
• CAZy Family: GH37
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573	MGYG000000107_1|CGC10	63874.86	5.901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 465791; End: 467512 Strand: -

Full Sequence      

MTSPVSRRPATLRLALGGAFVALATLTAQAEETRPTPQSPDILLGPLFNDVQSAKLFSDQ
KTFADAIPNGDPLMILADYRMQKNQTSFDLRHFVELNFTLPQENDQYVPPKGQTLRQHIN
GLWPVLTRSTVEVEKWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKIEDM
VTNFAAEIDAWGHIPNGNRTYYLSRSQPPFFPFMVELLATHDGDEALKKWLPQMEKEYQY
WMDGAEALQPGSASKRVVRMADGALLNRYWDDNDTPRPESWLDDVTTAKNNPNRPATEIY
RDLRSAAASGWDFSSRWMDNPQQLGTIRTTSIVPVDLNSLMFHMEKAIARASKAAGDSTK
AAKYDALANARQKALENYLWNDKEGWYADYDLKSHKVRNQLTAAALFPLYVNAASSERAA
KVAAATETRLLKPGGLTTTTVNSGQQWDAPNGWAPLQWVAAEGLQKYGQQKIAMEVSWRF
LSNVQHTYDSKQKLVEKYDVSSTGTGGGGGEYPLQDGFGWTNGVTLKMLDLVCPKEKPCD
SVPTARPAANDDIGSAQPAAHQPAAVEEKKAAQ

Enzyme Prediction     

EC	3.2.1.28

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	56	531	1e-188	0.9959266802443992

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13270	treF	0.0	47	531	62	545	alpha,alpha-trehalase TreF.
PRK13272	treA	0.0	8	535	4	539	alpha,alpha-trehalase TreA.
COG1626	TreA	0.0	28	538	42	558	Neutral trehalase [Carbohydrate transport and metabolism].
PRK13271	treA	0.0	1	552	1	556	alpha,alpha-trehalase TreA.
pfam01204	Trehalase	0.0	55	531	1	507	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVL83173.1	0.0	1	573	1	573
SQI94916.1	0.0	1	573	1	573
AWF38012.1	0.0	1	573	1	568
QSS42311.1	0.0	1	573	1	568
VEF68801.1	0.0	1	573	1	568

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	0.0	31	547	1	517	Family37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	0.0	39	553	46	560	Structureof periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	2.75e-316	31	547	1	517	Family37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
7E9U_A	3.36e-82	117	530	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	4.99e-81	117	530	123	552	ChainA, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7NUW3	0.0	1	547	1	547	Periplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) OX=585057 GN=treA PE=3 SV=1
P13482	0.0	1	547	1	547	Periplasmic trehalase OS=Escherichia coli (strain K12) OX=83333 GN=treA PE=1 SV=1
C4ZTN8	0.0	1	547	1	547	Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=treA PE=3 SV=1
B7UQ86	0.0	1	547	1	547	Periplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=treA PE=3 SV=1
Q0T5J8	0.0	1	547	1	547	Periplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) OX=373384 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000333	0.998772	0.000258	0.000257	0.000191	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_00405.