CAZyme Information: MGYG000000107_01143

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_01143
• CAZy Family: CE8
• CAZyme Description: Pectinesterase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418	MGYG000000107_1|CGC17	45996.4	8.1093

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 1250432; End: 1251688 Strand: -

Full Sequence      

MRIINILGISALLCTPLLLQGCVTQHPRGTASRPQLTAAEAASFTMERYFAQGGALSAPD
GPWSPSPVSLPQTESAWRVAPAGAPYSRIQQAVNAAIAQHSAKNERIYIRIEPGIYRETV
YIPAGAPPITLYGAGEQPEEVRIELALDSQFSAQRYREQVNGQHQYREGDPAWYQYALCA
GRTSKTIGTNCAAVMWSQSADFQLVNLSVANSLLDTVDGGTHQGVALRTDGDRVQLEKVR
LLGRQDTLYLNTSNLRNEAVTDRISRVYVKDSYVEGDVDYVFGRANAVFDNVHFHTVSTR
RSPEAYVLAPNTLPDNPYGFLVKNSRFTSDSGYQGSFKAKLGRAWDQGAGKTGYLAGQTA
NGQVLIANSAIDQSYDRLSPWGAAATTSRPFRGNISAERQLDDVAFNRLWEFKNHWRP

Enzyme Prediction     

EC	3.1.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	84	376	1.6e-58	0.7777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10531	PRK10531	0.0	7	414	15	416	putative acyl-CoA thioester hydrolase.
COG4677	PemB	7.30e-109	5	414	2	398	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02682	PLN02682	1.11e-21	81	345	77	289	pectinesterase family protein
PLN02773	PLN02773	1.60e-21	78	321	8	220	pectinesterase
PLN02432	PLN02432	1.35e-17	64	345	1	214	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQI92017.1	2.10e-307	1	418	1	418
VDY52283.1	2.10e-307	1	418	1	418
VEF69567.1	2.45e-306	1	418	1	418
AWF38218.1	2.45e-306	1	418	1	418
AVL82726.1	7.01e-306	1	418	1	418

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GRH_A	5.62e-100	25	414	29	409	Crystalstructure of escherichia coli ybhc [Escherichia coli K-12]
4PMH_A	4.59e-81	25	414	2	361	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]
3UW0_A	2.62e-14	188	379	110	307	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	8.22e-09	223	379	129	283	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1GQ8_A	9.86e-08	86	347	19	229	Pectinmethylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q47474	1.82e-168	8	412	8	425	Pectinesterase B OS=Dickeya dadantii (strain 3937) OX=198628 GN=pemB PE=1 SV=2
P55743	3.47e-153	24	414	4	396	Pectinesterase B OS=Pectobacterium parmentieri OX=1905730 GN=pemB PE=3 SV=2
P46130	3.58e-99	25	414	34	414	Putative acyl-CoA thioester hydrolase YbhC OS=Escherichia coli (strain K12) OX=83333 GN=ybhC PE=1 SV=2
E7CIP7	4.04e-80	25	414	18	377	Pectinesterase OS=Sitophilus oryzae OX=7048 GN=CE8-1 PE=1 SV=1
P24791	2.07e-44	30	414	30	389	Pectinesterase OS=Ralstonia solanacearum OX=305 GN=pme PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_01143.