CAZyme Information: MGYG000000107_05013

Basic Information

• Species: Klebsiella_A oxytoca
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Klebsiella_A; Klebsiella_A oxytoca
• CAZyme ID: MGYG000000107_05013
• CAZy Family: GH91
• CAZyme Description: Inulin fructotransferase [DFA-I-forming]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	MGYG000000107_11|CGC1	49252.25	5.6483

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000107	5859765	Isolate	Canada	North America

• Gene Location: Start: 61995; End: 63359 Strand: -

Full Sequence      

MTHNNYYDVTQWHIGNPYKDIGEVINSIILDIKNRQTATDMNNGGKPGAAIYIPPGDYHL
TTQVLIDISYLKIMGAGHGFVSSSIRFNTPADKWANLHDIWPGGSRILVDLCPQPGDEEH
AGAAFYVKRSGAPRISSVAFENFCIDGLHFIDDGLGNNDPENSYINGKTGIYIASAQDAF
RITGMGFIYLEHGLTTYNSDAMAIHNNFIAECGNCIELRGAGQASKITDNLIGAGYKGYS
IYAQNFGGLLISGNNIFPRGASSVHLSGVVRSTVTGNRLHSFYPGMLVLENNSAENLIAA
NHFFRDREPWPPMQTYDNGLDDAYGLLHINGSHNSLIANHISETIDIQYLKPLGIKPVII
RLVSGKGNYIANNHIVATTETSAAQAQPSEEDACFAAQVSALLTTARLKELDAVAVQVEK
ESAQNTILDSGSDDRVLMDRAVNAFRATPVPGTM

Enzyme Prediction     

EC	4.2.2.18	4.2.2.17	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH91	4	449	1.9e-194	0.9949367088607595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21111	IFTase	0.0	3	449	1	395	inulin fructotransferase. Inulin fructotransferase (IFTase; EC 4.2.2.17 and EC 4.2.2.18), a member of the glycoside hydrolase family 91, catalyzes depolymerization of beta-2,1-fructans inulin by successively removing the terminal difructosaccharide units as cyclic anhydrides via intramolecular fructosyl transfer. As a result, IFTase produces DFA-I (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,1'-dianhydride) and DFA-III (alpha-D-fructofuranose-beta-D-fructofuranose 2',1:2,3'-dianhydride).
pfam05048	NosD	3.39e-06	162	308	35	177	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam13229	Beta_helix	0.005	214	305	1	89	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam18835	Beta_helix_2	0.006	352	380	3	31	Beta helix repeat of Inulin fructotransferase. This region contains a right-handed parallel beta helix repeat unit found in Inulin fructotransferase. This Pfam entry includes sequences not found by pfam13229.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APB46433.1	0.0	1	454	1	454
VEF66677.1	0.0	1	454	1	454
AKL07096.1	0.0	1	454	1	454
SQI99036.1	0.0	1	454	1	454
AWF36419.1	0.0	1	454	1	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZKS_A	4.81e-210	1	452	1	444	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZKU_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKU_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZKW_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_B Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_C Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_D Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_E Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6],5ZKW_F Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
5ZL5_A	1.12e-208	1	452	1	444	Crystalstructure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_B Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_C Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_D Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_E Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZL5_F Crystal structure of DFA-IIIase mutant C387A from Arthrobacter chlorophenolicus A6 [Pseudarthrobacter chlorophenolicus A6],5ZLA_A Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_B Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_C Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_D Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_E Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6],5ZLA_F Crystal structure of mutant C387A of DFA-IIIase from Arthrobacter chlorophenolicus A6 in complex with DFA-III [Pseudarthrobacter chlorophenolicus A6]
5ZKY_A	7.35e-201	1	452	1	419	Crystalstructure of DFA-IIIase from Arthrobacter chlorophenolicus A6 without its lid [Pseudarthrobacter chlorophenolicus A6],5ZL4_A Crystal structure of DFA-IIIase from Arthrobacter chlorophenolicus A6 wihout its lid in complex with GF2 [Pseudarthrobacter chlorophenolicus A6]
2INU_A	2.35e-111	5	376	13	369	Crystalstructure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_B Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INU_C Crystal structure of Inulin fructotransferase in the absence of substrate [Bacillus sp. snu-7],2INV_A Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_B Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7],2INV_C Crystal structure of Inulin fructotransferase in the presence of di-fructose [Bacillus sp. snu-7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19870	6.37e-89	4	376	3	353	Inulin fructotransferase [DFA-I-forming] OS=Arthrobacter globiformis OX=1665 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999853	0.000180	0.000004	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000107_05013.