CAZyme Information: MGYG000000108_02925

Basic Information

• Species: Citrobacter freundii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter freundii
• CAZyme ID: MGYG000000108_02925
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		36842.51	6.4989

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000108	4739906	Isolate	Canada	North America

• Gene Location: Start: 667978; End: 668967 Strand: +

Full Sequence      

MDNKPFISVSIKTLNESECIEKTIDSIRKQLIDYPHKIIVADSLSTDNTQQLAIDKGVTV
VSLTDPGDRCCGVGHQLGYLYSEGEYLLLMDGDMELEEGFVDQAVAFLQAEPEYAGVAGT
VEMDDAVNYEFKSRKQRINKIYPLGDSDHLGGGGLYRRSAIEKVGYLTNRNLHAYEEAEL
GLRLIEAGYKLRRLDIPYFIHTSHTMPTFQMLKHRWKSGYYQAPGELLRCAWGKPYFGKA
LKMVRNEAIFSVYLIGLFIAAVTFNLELFDIAFLPLLAFIALKTVQNRSLLNGLQSVMNL
AVLSAGLVKGLTKPVRDPLTPPNSKIIHE

Enzyme Prediction     

No EC number prediction in MGYG000000108_02925.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	2.63e-21	6	192	1	198	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1215	BcsA	3.77e-19	5	329	54	383	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04186	GT_2_like_c	1.27e-17	9	192	1	155	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.69e-16	3	255	1	253	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06423	CESA_like	7.88e-16	15	172	7	177	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJT74775.1	1.52e-239	1	329	1	329
QNB18216.1	1.52e-239	1	329	1	329
QLN72048.1	1.52e-239	1	329	1	329
QKX80738.1	1.52e-239	1	329	1	329
QLV29477.1	1.52e-239	1	329	1	329

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
249	271