CAZyme Information: MGYG000000108_04406

Basic Information

• Species: Citrobacter freundii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter freundii
• CAZyme ID: MGYG000000108_04406
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000108_10|CGC1	44639.93	10.377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000108	4739906	Isolate	Canada	North America

• Gene Location: Start: 40763; End: 41983 Strand: +

Full Sequence      

MDDGTSIAADQDLWAFIGDELKMGIPENSRIREQKQKYLRNKSYLHDVTLRAEPYMYWIA
GQVKKRNMPMELVLLPIVESAFDPHATSGANAAGIWQIIPSTGRNYGLKQTRSYDARRDV
VASTTAALDMMQRLNKMFDGDWLLTVAAYNSGEGRVMKAIKTNKARGKPTDFWSLPLPQE
TKLYVPKMLALSDILKNSKRYGVRLPTTDESRALARVRLSSPVEMAQVADMAGISVSKLK
TFNAGVKGSTLGASGPQYVMVPKKHAEKLRESLASGEIAAVQSTLVADNTPLNSRSYKVR
SGDTLSGVASRLGVSINDLKQWNNLRGSSLKVGQNLAVGAGSSAQRLANNSDSITYRVRK
GDSLSSIAKRHGVNIKDVMRWNSDTNNLQPGDQLTLFVKNNDMPDS

Enzyme Prediction     

No EC number prediction in MGYG000000108_04406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	198	3.7e-23	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10783	mltD	0.0	1	406	50	456	membrane-bound lytic murein transglycosylase D; Provisional
cd16894	MltD-like	1.17e-61	63	193	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	5.83e-37	58	168	1	111	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	9.93e-20	78	190	10	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.76e-18	54	190	5	144	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD5359052.1	1.01e-292	1	406	1	406
ANZ88843.1	1.01e-292	1	406	1	406
VDZ55360.1	4.10e-292	1	406	1	406
ASK00682.1	5.73e-292	1	406	47	452
QFX91342.1	5.73e-292	1	406	47	452

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1E0G_A	3.05e-24	352	399	1	48	LYSMDomain from E.coli MLTD [Escherichia coli]
2MKX_A	3.51e-07	297	342	7	52	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ8	2.56e-273	1	406	47	452	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P0AEZ7	2.56e-273	1	406	47	452	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P32820	1.25e-33	44	199	10	168	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P37710	5.23e-12	227	388	373	531	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.65e-10	296	396	413	530	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000108_04406.