CAZyme Information: MGYG000000109_01323

Basic Information

• Species: Streptococcus sp004166885
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp004166885
• CAZyme ID: MGYG000000109_01323
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325	MGYG000000109_1|CGC18	37147.35	9.7138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000109	2017268	Isolate	Canada	North America

• Gene Location: Start: 1337144; End: 1338121 Strand: -

Full Sequence      

MTIIDRTGTGGKAGVLNDALKMATGDYICVYDADAMPEKNALYFLVKEVLKDPERHVASF
GRNKTRNANQNFLTRCINQEIVVTQRVHHVGMWNLFKIGRIPGTNFIIQTEFVKSIGGWK
NGALTEDTDISFKIMQSGKLIALAYNSEAFQQEPETLKTYYMQRKRWAKGNYEVVLSNFK
HLFGKGNWRVKLEVFNYSCIFFWFNAAIVLSDLIFFANVLAMFIHLFAPGVQIPFAFDSE
NIYIAQLMLFNWVLMIGLYLLQINIAMASQFGQATVKQIWLALAAYFSYSQLFIIVSIDS
ISSIIMDKLLHREGTKWVKTKRFAG

Enzyme Prediction     

No EC number prediction in MGYG000000109_01323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	27	224	6.5e-18	0.9238578680203046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	3.67e-35	1	127	55	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.44e-30	3	261	116	371	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	7.38e-23	11	267	121	361	N-glycosyltransferase; Provisional
cd06421	CESA_CelA_like	1.43e-17	6	174	66	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	7.59e-17	5	170	70	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SQH65599.1	1.97e-234	1	325	90	414
AGY40741.1	4.42e-234	1	325	112	436
AGY37424.1	4.42e-234	1	325	112	436
AYF93493.1	8.51e-232	1	325	112	436
AFJ25303.1	3.88e-221	1	325	112	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.01e-06	12	176	214	380	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.04e-06	12	176	226	392	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.04e-06	12	176	227	393	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	4.40e-06	12	186	340	515	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	1.01e-48	11	323	121	414	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q7A351	8.05e-14	4	179	106	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	8.05e-14	4	179	106	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	8.05e-14	4	179	106	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	8.05e-14	4	179	106	279	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
202	224
244	266
279	301