CAZyme Information: MGYG000000109_01484

Basic Information

• Species: Streptococcus sp004166885
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp004166885
• CAZyme ID: MGYG000000109_01484
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000000109_2|CGC2	39306.76	6.3398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000109	2017268	Isolate	Canada	North America

• Gene Location: Start: 117860; End: 118912 Strand: +

Full Sequence      

MKYYLKEEFLHDVNAKNAGNKARNDVESIVKEEGYHPLVLSVDNWYQMSTLAAQRHKAKA
FGQALDQLKQGDELLIQFPMLHHSFFSTHLVKKAQKRGIKVYLLIHDLEVLRHANMTSLP
LKHRIRMYLQEASFLKTADGIIAHNPVMKSVLVDKGIAEDKIVSLGIFDYMIPDYQEKDG
LSKDQPIIVAGNLAQEKAGYLYALPAKPAYNLYGVGFDESRALENETYFGSFLPDELPAA
LEGGFGLVWDGDSAETCNGVFGEYLRYNNSHKASLYLASGFPLVVWKQSALSHFVLEKGC
GIAVESLHDLKETIDNLSDADYQDLVDNAKRVGQEIRDGHYLKTALNHLS

Enzyme Prediction     

No EC number prediction in MGYG000000109_01484.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	14	349	4e-105	0.9751552795031055

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.10e-99	1	346	1	326	sugar transferase.
cd03794	GT4_WbuB-like	4.91e-11	91	319	116	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG0438	RfaB	0.002	31	331	44	355	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC34319.1	1.83e-221	1	349	1	349
AGY39025.1	3.69e-221	1	350	1	350
ARC49781.1	3.69e-221	1	349	1	349
CCB95362.1	3.53e-219	1	349	1	349
AMB82748.1	2.27e-215	1	349	1	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	9.60e-49	9	349	3	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
B3XPQ7	5.39e-21	10	346	8	325	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	1.34e-19	10	346	13	330	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1
Q9AEU1	3.19e-19	10	346	8	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000109_01484.