CAZyme Information: MGYG000000109_01485

Basic Information

• Species: Streptococcus sp004166885
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp004166885
• CAZyme ID: MGYG000000109_01485
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1052	MGYG000000109_2|CGC2	115130.65	6.912

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000109	2017268	Isolate	Canada	North America

• Gene Location: Start: 119057; End: 122215 Strand: +

Full Sequence      

MKKKDLIFYAGAAVLMAVSAQGVSADELVSNEATTTEGNQVQAEKAPEVAVAEKSVAPIA
SNYAAPANVTEQPVAPASKVAASESGTPSVEKAVEASTTEKEETPLPSDTGSTTFFNTGT
HAPAGRSTDVAVQPKSFVDVSSHNGEISIGDYRTLANKGVGGVVVKLTEDTWYKNPNAEN
QIRNAQAAGLQVSTYHFSRYTSEEAARTEARFYIAAAQRLNLPKNTLMVNDFEDAKMQPN
INRTTQAWEDEMRKNGYTNLMFYTSASWLDENNLRKKGPVNTSQFGLQNFWVAQYPSPKL
SVNDAKSLRYNGKAGAWQFTSQAELLPGKHLFDHSVDYTGRFTANAKPAADPTEGSLSGK
IDIVNNDTMTGRFDVVISNVKAPNGVRTVSVPIWSETGGQDDLVWYTANRQANGTYTVNV
KAADHKNSTGLYNIHLYYVQNNGQMTGVGGTTTTVAIGKKNQTPVSADLTIAKSEKDGTF
TITAKNLQGFDGYKEVKIPFWSHANGMKDIIWYTPTRQADGSYTVTAKASDHENSDGKYE
AQVFYVDAKGQNKFVKKAFIDYTAPKPSADLTITKSESDGTFTITAKNLQGFDGYKEVKI
PFWSHANGMKDIIWYTPTRQADGSYTVTAKASDHENADGKYEAQVFYVDVQGQNKFVKKA
FIDYKNQSRPTGTLLIQNNNKDTGTFDVIIKDVYSPKGVQTVQVPSWSDKDGQDDIRWYE
ATRQANGDYKVSVKASDHKNSTGKYHIHLYYIQNDGSRVGVGSTTTEVEFRNAQTKTQAA
IKNVNSGAGTFTVTVDQAPQGRQIKNIRVAAWSKAHQENLYWYSATPTGMHTEITVSANN
HGNEAGNYTTHVYVDYKDGGVEGFNLGQTALSPRNQKVNPQTTYYSQRDPRWGAKWYGVS
NMDQSGCVPTSLAMAFTDILGREVLPTTVADYLYYNTNSFNKIAVAGTDADGLVAATKHW
GLTSQMLTGKDAIAATLVSGKHVLAAVEESIFINAPYTHEIVLQGYDNGKTYVRDPFNPA
NNGWHSIDYIFSVKSTDPIDAKLGSPFFSVFA

Enzyme Prediction     

No EC number prediction in MGYG000000109_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	138	324	5.1e-40	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06522	GH25_AtlA-like	1.71e-77	135	338	1	192	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.
pfam01183	Glyco_hydro_25	8.46e-36	138	322	1	174	Glycosyl hydrolases family 25.
pfam08481	GBS_Bsp-like	7.85e-33	676	764	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	5.92e-31	363	445	1	83	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
cd00599	GH25_muramidase	5.25e-26	137	333	2	182	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGY39024.1	0.0	1	1052	1	1157
QEW10542.1	0.0	1	1052	1	1156
QUB38816.1	0.0	1	1052	1	1155
ARC22445.1	0.0	1	1052	1	1183
ARC34341.1	0.0	1	1052	1	1183

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000336	0.998844	0.000325	0.000167	0.000165	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000109_01485.