CAZyme Information: MGYG000000109_01486

Basic Information

• Species: Streptococcus sp004166885
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp004166885
• CAZyme ID: MGYG000000109_01486
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000000109_2|CGC2	90572.17	7.0038

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000109	2017268	Isolate	Canada	North America

• Gene Location: Start: 122468; End: 124930 Strand: +

Full Sequence      

MKKKDLIFYAGTAVLLAFSTQQVKADEQHASDQTPENTSAVVLKTTTSSEAQNTVNEGVG
VEKGIQTENVVATEAVPDTPTLSNNQSFDKGTSDKVISEQPAPAVVASRAPYGARARVVE
TRNESVPQQESPVSADLNIEKSDSEGTFTITAKNLQGLDGYKEVKIPFWSHANGMKDIIW
YTPSRQADGSYTVTAKASDHENSDGKYEAQVFYVDAKGQNKFVKKAFIDYTAPKPSADLT
ITKSESDGTFTITAKNLQGFDGYKEVKIPFWSHANGMKDIIWYTPTRQADGSYTVTAKAS
DHENADGKYEAQVFYVDAKGQNKFVKKAFIDYTASKPSADLTITKSEKDGTFTITAKNLQ
GFDGYKEVKIPLWSHANGMKDIIWYTPTRQADGSYTVTAKASDHENADGQYEAQVFYVDA
KGQNKFVKKAFIDFKNQSRPTASLLIQNNNKDTGTFDVIIKDVYSPKGVRTVQVPTWSDK
DGQDDIRWYEATRQANGDYKVSVKASDHKNSTGKYHVHLYYIQNDGSRVGAGTTTTEVEF
RNLTTRTQTGIKNVNSGAGTYTVTVDQAPQGRQIKNIRVAAWSQAHQENLYWYSTAPSGT
HTEVQVSAANHQYQKGNYTTHVYVDYVDGGVEGFNLGQTALSPREIVDQAAYNPHVSNGQ
RDRVLRAAASLVGVRSGSAAHHQLVKDYNSVNPLPVGYAVKNTDDWCDVFVTTVFQREGL
SHLIGRECGVERHIQIFKRLGIWNEDGASTPKSGDIITFNWDQDYQQNDGFADHIGIVER
VENGLIHTIEGNSGVVGTVKRNVYRIGHGNIRGFATPRYK

Enzyme Prediction     

No EC number prediction in MGYG000000109_01486.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08481	GBS_Bsp-like	1.20e-32	446	534	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	3.95e-19	144	225	7	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	5.72e-19	242	327	3	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	1.03e-18	344	429	3	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam05257	CHAP	2.34e-07	747	792	42	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL83937.1	0.0	132	820	462	1156
AFJ26940.1	0.0	132	820	680	1374
AEH56405.1	0.0	132	820	574	1268
AGY39024.1	0.0	128	644	459	979
AAN64579.1	7.92e-283	113	820	672	1366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000283	0.999010	0.000217	0.000161	0.000152	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000109_01486.