CAZyme Information: MGYG000000110_00836

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_00836
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369	MGYG000000110_1|CGC16	42375.31	6.4316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 862625; End: 863734 Strand: -

Full Sequence      

MDRKQLQFSAAQTVQITESLIDALVNIRDENGAFLMTLADGRVVDTKGWGGWEWTHGIGL
YGLWKYWQQTRDPRWKAIVEQWFSDRFKEGTPTKNVNTMAPMLTLAALYEESGHTPWRRY
IEIWANWVMYDMPRTELGGLQHMTFNYAHHQQLWDDTLMVSVMPLAKAGLVLNRPEWVAE
AKRQFLLHSQYLCDAPTGLWYHGWNFEGRHHYAKALWGRGNSWVTVAIPDFIEMLNLPEG
DPVREFLLGQLSRQVEALAARQDGESGLWHTLLDDPTSYLESSASAGFAYGILKAVRKRY
IDKRFLATGIAAAEGVMRQITPQGELQHVSFGTGMGKDLDYYRNIERTTMPYGQAMAMLA
LIEYQNLFI

Enzyme Prediction     

No EC number prediction in MGYG000000110_00836.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	49	365	8.6e-107	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.97e-102	23	364	7	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.44e-98	26	368	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV66281.1	6.96e-263	1	369	1	369
ACT14395.1	5.01e-168	20	369	31	379
QPI43966.1	5.01e-168	20	369	31	379
QJA21480.1	7.11e-168	20	369	31	379
AKG71743.1	1.43e-167	9	369	20	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	7.79e-155	3	364	16	377	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	4.70e-151	24	364	37	376	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	1.14e-137	7	369	2	373	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	5.41e-24	52	368	39	368	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	2.30e-23	52	368	29	358	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.83e-45	52	358	29	329	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	2.96e-23	52	368	39	368	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	3.27e-11	154	363	201	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	1.07e-09	169	297	10	143	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.07e-09	169	297	10	143	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_00836.