CAZyme Information: MGYG000000110_00978

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_00978
• CAZy Family: GH24
• CAZyme Description: Lysozyme RrrD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
177	MGYG000000110_1|CGC19	19243.18	8.8849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 1003673; End: 1004206 Strand: -

Full Sequence      

MGNKAKFSAAMLALLAAGATAPELFDQFVSEKEGNALVAVVDPGGVWSLCHGVTVIDGKR
IVKGQTATETQCKKVNAIERDKALAWVDRKIKVPLTEPQKVGIASFCPYNIGPGKCYPST
FYKRMNAGDTKGACEAIRWWIKDGGRDCRLTKGQKNGCFGQVERRDQESALTCWGLD

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	27	168	1.6e-34	0.948905109489051

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16900	endolysin_R21-like	6.92e-51	27	173	10	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	3.49e-46	22	177	8	152	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam00959	Phage_lysozyme	4.80e-25	46	166	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd00737	lyz_endolysin_autolysin	7.25e-23	27	146	3	119	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	1.10e-11	33	171	14	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT71286.1	9.06e-127	1	177	1	177
QIR27801.1	1.24e-126	1	177	1	177
BBV66723.1	1.76e-124	1	177	1	177
QGH30460.1	2.80e-121	1	177	1	177
QGH39442.1	2.80e-121	1	177	1	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HDF_A	9.64e-20	33	175	10	138	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	1.76e-19	33	175	35	163	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]
4ZPU_A	4.36e-19	33	175	35	163	Thestructure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_B The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_C The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12],4ZPU_D The structure of DLP12 endolysin exhibits likely active and inactive conformations. [Escherichia coli K-12]
7M5I_A	7.60e-16	33	171	21	152	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6ET6_A	3.11e-14	27	171	58	192	ChainA, Lysozyme [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O64362	2.59e-102	1	177	1	177	SAR-endolysin OS=Escherichia phage N15 OX=40631 GN=54 PE=3 SV=1
P68920	2.72e-90	1	177	1	176	SAR-endolysin OS=Escherichia phage 933W OX=10730 GN=R PE=3 SV=1
P68921	2.72e-90	1	177	1	176	SAR-endolysin OS=Enterobacteria phage VT2-Sa OX=97081 GN=R PE=3 SV=1
P76159	1.10e-89	1	177	1	176	Probable prophage lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=rrrQ PE=3 SV=1
Q9ZXB7	5.23e-88	8	177	10	176	SAR-endolysin OS=Enterobacteria phage H19B OX=69932 GN=R PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.265240	0.732455	0.001454	0.000316	0.000247	0.000266

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_00978.