CAZyme Information: MGYG000000110_01030

Basic Information

• Species: Kluyvera sp902363335
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera sp902363335
• CAZyme ID: MGYG000000110_01030
• CAZy Family: GH4
• CAZyme Description: Alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
450	MGYG000000110_1|CGC20	50581.76	5.6632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000110	4775474	Isolate	Canada	North America

• Gene Location: Start: 1045250; End: 1046602 Strand: -

Full Sequence      

MTAPKITFIGAGSTIFVKNILGDVFHREALKSAHIALMDIDETRLEESHIVVRKLMDSAG
ASGHITCHTDQRAALQNADFVVVAFQIGGYEPCTVTDFDVCKRHGLEQTIADTLGPGGIM
RALRTIPHLWRICDDMTDVCPNATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTAE
ELARDLDIDPATLRYRSAGINHMAFYLELERKTADGNYVDLYPELLAAYAEGKAPKANLH
GNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIERYKVPLDEYPKRCVE
QLANWHKELEEYKTAERIDIKPSREYASTIMNAIWTGEPSVIYGNVRNDGLIDNLPQGSC
VEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPHT
AAVLGIEEIYALVDDLIASHGNWLPAWLHR

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	5	185	1.3e-71	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	0.0	4	437	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
PRK15076	PRK15076	0.0	3	448	1	431	alpha-galactosidase; Provisional
COG1486	CelF	0.0	1	450	1	442	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
pfam02056	Glyco_hydro_4	7.71e-94	5	188	1	183	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	2.24e-66	5	444	2	419	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGH30524.1	0.0	1	450	1	450
QGH39506.1	0.0	1	450	1	450
VDZ83694.1	0.0	1	450	1	450
BBV66511.1	0.0	1	450	1	450
AIR66005.1	0.0	1	450	1	450

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C3M_A	9.28e-33	5	450	6	440	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3FEF_A	4.69e-32	5	418	7	419	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
1S6Y_A	1.81e-29	5	450	9	443	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
6DUX_A	4.15e-23	5	445	8	440	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]
1U8X_X	1.95e-20	5	445	30	462	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P30877	0.0	1	450	2	451	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2
P06720	0.0	1	450	2	451	Alpha-galactosidase OS=Escherichia coli (strain K12) OX=83333 GN=melA PE=1 SV=1
O34645	9.78e-139	5	447	3	431	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1
Q9X4Y0	5.20e-66	1	449	1	444	Alpha-galactosidase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=melA PE=3 SV=1
Q9AI65	4.90e-45	3	444	2	449	Alpha-glucosidase OS=Erwinia rhapontici OX=55212 GN=palH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000087	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000110_01030.