CAZyme Information: MGYG000000111_00139

Basic Information

• Species: Cutibacterium acnes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Cutibacterium; Cutibacterium acnes
• CAZyme ID: MGYG000000111_00139
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393	MGYG000000111_1|CGC3	42996.91	9.7642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000111	2484103	Isolate	Canada	North America

• Gene Location: Start: 138424; End: 139605 Strand: -

Full Sequence      

MTLEGDGPAVPTKRESLSFFWPTIAVIMTTVTRTLIMPSPIDLKIYRDCVRAMLDDPRTL
YTASSVSGLGFTYPPFAAIALIPLALIPSLTVTVLHYAVSAIALVVMIDLIWQRCGHTSR
PFLTAVLVGVLNFSEPIGKTFVYGQVNLQLALLVIVDVFLLPRKWRGVGIGVATGFKLTP
GIFALWYLVTGQFKAALRAAAAGLATIAIGFAAMPTASWEYWTHYMVTPNRLGGLTWAGN
QSLSGLLLRLGHGNHTLVWLVLVALCCVLAGVASRRLWQGGGADHVWSLLCAGLCGCLVS
PVSWSHHWVWGSLIIVAGLADRRRCRQVLALIWALATLTWMVWWFPAGHNRELAATWWQK
ILTDAYELVGVATLVVLAWNRRRCESGVLAPRA

Enzyme Prediction     

No EC number prediction in MGYG000000111_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	71	301	3.2e-67	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09594	GT87	3.07e-32	71	301	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
PRK13375	pimE	5.06e-31	41	392	45	405	mannosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALD69355.1	2.20e-294	1	393	1	393
AER06664.1	2.20e-294	1	393	1	393
BCY25639.1	1.90e-247	1	392	1	392
AOH46524.1	1.90e-247	1	392	1	392
ALT34953.1	1.43e-241	1	377	1	376

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R036	1.98e-45	37	377	43	411	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WMZ8	4.39e-42	38	376	42	401	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	4.39e-42	38	376	42	401	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
P9WN00	1.08e-32	41	379	69	414	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	1.08e-32	41	379	69	414	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.993693	0.006269	0.000013	0.000014	0.000011	0.000030

TMHMM  Annotations     

start	end
20	39
60	82
86	108
121	143
167	189
196	218
256	273
328	347
357	379