CAZyme Information: MGYG000000111_00981

Basic Information

• Species: Cutibacterium acnes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Cutibacterium; Cutibacterium acnes
• CAZyme ID: MGYG000000111_00981
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
920	MGYG000000111_2|CGC2	97095.06	4.465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000111	2484103	Isolate	Canada	North America

• Gene Location: Start: 144595; End: 147357 Strand: +

Full Sequence      

MKISPVRARIHGALAVVALLLLVVGSPAALVAWGHLDATTVLRPAGWLAPDDGSIFLTVV
TVIGWAAWTVFCVCVVAEAVGMATSQRHHVRFPGLGAIQGIAAGLLVASLTVLSPLTRSA
VPPAPVSLVATAAAVPQPAPEAQVDSDSGHDEDVMTVTVGPHDDLWTLAETWYGDGTSWR
RIVAANPDVDVDHLVVGQRLALPGATVTMPAGHTGVGRPIDTEQLNQIAPPSEMSKVRTI
TVEQGDTLSGIAQTQLGDASSWPAIWHLNEGTIADPDHIEPGWELVLPDSPTVDMRTSDQ
HTDEQGGKREKSTPAETPTTESTPPVLPAGGGDTTATVNETKVEPHTAAGANQAMSMAEV
GQSPAEIFRTALAGLSLFLAGGVAGTVTTRRRQQLFTRPLGRRIPPVSGEPRRAKRVLDA
AADQLDESASSRDTAALAMTPTTVVLGTCDPQTPVVVDLADVGGVLAVNAARDLATAMVA
SISLSLVAAPWSGGIDIVAVGEDLAWLAHTGSDDVQLADEDEVVEGLAGLSNEASEYPGA
ITRVVLSSSPLNLPSLASLAAAGIVIVMPGVGGQEITVTDCDHAEFDGQSFTPQIVTSPM
RRAVVELLETTARSDTEPAPWWEPRRGDEEGSDPPPVMAKPCAVLPPSDAHLTVEEETVL
TSTMTSDVAHLPATGGQVPSPILRLLGPVDLLGARGNPPTKARRQCLEYCAWLLCHPGAR
SVQMADALMVAEPTRRSNVSRLRRWLGTDDAGRAYLPEGYDGSLRLADAVTSDWERLELL
VSGGVSTAPLANLVSALDLVRGAPLADAAPGQWHWAEEWRIDMIQMVRDIGVEVARRAME
IRDVELASRALARATVACPEDEVLLVARIKLADELDDRGEVERLVYVLSRQARRLGVDLS
DETVTVLQEVMEGHARARVV

Enzyme Prediction     

No EC number prediction in MGYG000000111_00981.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	7.30e-10	215	289	78	147	LysM domain/BON superfamily protein; Provisional
smart01043	BTAD	1.18e-07	773	911	2	145	Bacterial transcriptional activator domain. Found in the DNRI/REDD/AFSR family of regulators. This region of AFSR along with the C terminal region is capable of independently directing actinorhodin production. This family contains TPR repeats.
cd00118	LysM	3.31e-06	156	202	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
cd00118	LysM	1.64e-05	238	287	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	3.61e-05	240	288	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALD68825.1	0.0	1	920	1	920
BBJ76899.1	0.0	1	920	1	920
AID35057.1	0.0	1	920	1	920
QAZ47705.1	0.0	1	920	1	920
AXM07036.1	0.0	1	920	1	920

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WM38	1.51e-06	154	287	2	152	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	1.51e-06	154	287	2	152	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999085	0.000928	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35
55	77
90	112