CAZyme Information: MGYG000000111_01022

Basic Information

• Species: Cutibacterium acnes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Propionibacteriales; Propionibacteriaceae; Cutibacterium; Cutibacterium acnes
• CAZyme ID: MGYG000000111_01022
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000000111_2|CGC5	81895.99	5.669

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000111	2484103	Isolate	Canada	North America

• Gene Location: Start: 197892; End: 200102 Strand: +

Full Sequence      

MLAESWRLHYRSPAAEWEAYGLPIGNGRLGAVLRGDIAHDVVQFNENSLWAGSNNYDNGL
CGVADDVFDTSMHGFGRYLDFGRVTISFAGLEESTVSGYERGLDLRRAVAHTCFDAGGVR
HQRSAFASREADVIVLRYSASAPFGCTVRLESAQGVPSRVAGDTSVVFDGVLGNGLRYCA
SLVVLECDGRSIAHGDRIVVADATTLALVLDAGTDYALSAVAGWRGVNPRPVVDERICSA
MALGWGRLHDAHVTNFSAVMDRCRLRWGRSVPELDAQPTDERLRRYRDGAADVGLEQLAV
VLGRYLLVSSSRAEGLPANLQGLWNDSNDPAWGSDYHTNINVQMNYWGAEVTGQSEEHMA
LLNFVEEVAVPSRSATRAMCGPDVPGWTARTSQSPLGGNGWKPNTMASAWYAHHVYEHWA
FTRDDEWLRTRGLPMLAEICRFWEHQLVERDDGMIVAPAGWSPEHGPREDGVAYDQQIVW
DLFTNLLECSRALGVEDDLYYRVERLRDRLAPNQVGCWGQLQEWQDDRDDPTELHRHTSH
LFAVYPGRQITTDTPELQAAALVSLKARCGEPPPVVGAPTAAPFRAEMVVGDSRRSWTWP
WRAALFARLGDGYRAGEMVRGLLTYNMLPNLWTTHPPFQVDGNLGLVGAVAEMLLQSHDG
RIRLLPALPPAWEAEGEVIGLRARGGYRVSMQWRDGWVTWFEIVADRGHAEDVIIVVNGR
EHWIRPDKRRPWSRHL

Enzyme Prediction     

No EC number prediction in MGYG000000111_01022.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	4	717	5.4e-228	0.9833795013850416

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	2.09e-49	8	216	1	231	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
COG1554	ATH1	5.08e-04	398	452	421	479	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AER05511.1	0.0	1	736	1	736
ALD68860.1	0.0	1	736	1	736
AYW79288.1	0.0	1	729	1	729
ADD99728.1	0.0	1	729	1	729
ALT36729.1	0.0	1	729	1	729

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMQ_A	1.12e-108	3	708	38	752	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
4UFC_A	5.40e-100	7	695	23	723	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2RDY_A	3.46e-98	5	720	2	759	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	2.30e-85	17	723	47	859	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	1.62e-84	17	723	47	859	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2R797	7.00e-86	23	699	40	762	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q8L7W8	1.27e-83	2	707	48	806	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
Q5AU81	1.12e-75	21	718	43	800	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.22e-54	10	693	19	694	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000111_01022.