CAZyme Information: MGYG000000112_00013

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_00013
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	MGYG000000112_1|CGC1	57910.1	9.3406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 14400; End: 15941 Strand: -

Full Sequence      

MPFDTERLTHMSWSFGMFVVLICLLILLACLAVKLLFKRRLGLRVVRDRSAGGSRTLIVR
TPVTTTDEAQRSADATGLPRALMGISGPPPVILVALGLVGWLFWRVLVSWHHVLDEWAVW
TFDVLFLLVAAQLVLACFEGRVAGDEDFRVAVLVPLYNEDPDVVVRMLSALLHQSSPPAE
IHVVDDGSTQSTYLEQRDWFIRQAAVAGIYATWQRTANEGKRHAQVHGFRKIRNAELFVT
VDSDSMLDAEALREIVQPFSDPRVMSVAGVILAINNRENLLARVTDVIFVGQQLVDRSSM
SQLGSVMVDSGGLAAYRCRILAENIDIYMNESYLGRHVEFSDDSMLTLFALLNGRTVQQP
SAFAFAWMPDRWSHHYRQQVRWFRGSFIRGLWRIRFLPVLSWGWWRQATGWMQIWAVTSG
FVYLALWRPLATGDSVPLAVVLVPLTIGLAQNSRYLNVWRSDTTDSARRASLLLSPVATL
WSAVILRPLRFWGVVTSGKMGWNTRQQVEVTSQ

Enzyme Prediction     

No EC number prediction in MGYG000000112_00013.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	152	322	1.8e-19	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	8.00e-32	152	323	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06434	GT2_HAS	9.98e-29	150	387	2	233	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
COG1215	BcsA	3.12e-23	139	500	45	380	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	4.22e-16	149	381	30	243	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam00535	Glycos_transf_2	5.44e-16	152	321	2	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI18220.1	5.56e-310	11	513	1	504
QQQ59038.1	9.07e-299	11	513	1	510
QQC39714.1	3.88e-294	11	513	1	514
QLF54319.1	7.00e-294	11	513	1	511
AMD99051.1	3.89e-293	11	513	1	510

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5X9A9	6.07e-43	138	510	54	417	Hyaluronan synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=hasA PE=3 SV=1
P0DB61	6.07e-43	138	510	54	417	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=hasA PE=3 SV=1
P0DB60	6.07e-43	138	510	54	417	Hyaluronan synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=hasA PE=3 SV=1
Q8NKX1	8.40e-43	138	510	57	417	Hyaluronan synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=hasA PE=3 SV=1
P0C0H0	8.40e-43	138	510	57	417	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000080	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
81	103
118	140
414	431
436	458
470	492