CAZyme Information: MGYG000000112_00139

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_00139
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339		35847.09	4.411

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 157184; End: 158203 Strand: -

Full Sequence      

MKTRRVTQLLMTAGLAVATATACLPIQPQGGDPGTAASSAGARTERPSPSSSAGATASSS
PGGAPSVPAAPSSSAEQPTDGGPSGEPSASASPSDAGTATPSQPSGQGRSDAQINGWSID
YFEGFDSSLEDLGWEHYGWGDPSVGHGAMGVMSRKNSFTQNGELIVRTQYQDGQWSAGGT
SSENVFAASRGRWEVRAKFPRAKGIGYVFLLWPQDQGWPPEIDFAEGRVNGPRVEGTYHW
DPDNKQAQQVLDNDDMGGWHTYGVIVEDNLITFTLDGQEWGRIERSITDKRMFFGVQTGA
MDPNGDAKQYETVDGGVPGPLTPAVSDIQIDYVAHYTRG

Enzyme Prediction     

No EC number prediction in MGYG000000112_00139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	117	336	1.6e-24	0.9947089947089947

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00413	Glyco_hydrolase_16	1.99e-21	122	336	3	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd08023	GH16_laminarinase_like	1.21e-18	117	286	1	187	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
pfam00722	Glyco_hydro_16	2.92e-08	174	278	19	123	Glycosyl hydrolases family 16.
cd08024	GH16_CCF	4.75e-08	120	279	5	227	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
COG2273	BglS	2.47e-07	79	337	15	261	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC11310.1	6.93e-139	98	338	24	269
AFN47003.1	6.93e-139	98	338	24	269
VEH71591.1	6.93e-139	98	338	24	269
QCT39060.1	1.92e-137	98	338	119	364
QUC13994.1	3.91e-136	98	338	24	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O33680	6.86e-07	175	337	303	458	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000007	1.000010	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000112_00139.