CAZyme Information: MGYG000000112_00609

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_00609
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
444	MGYG000000112_1|CGC9	48843.73	9.5367

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 723962; End: 725296 Strand: -

Full Sequence      

MSIADNPQHESLSSRPGSGTDDRQDHEERASVPRFSRLVAATRAPVVAILGWLALLVPAH
RSLVDESGQWVFKLDSFVYYEAVHQWLNGGDLYNWYANPPQHLWPFTYTPLAAWVITPLT
WMSYQSATALLVVATPLCAAVTTYAVLRRLGARIRTAHGLAPWIALLGVVVLEPFPKTME
YAQVNAILMALVAVDLLVVPGRSRWRGVLSGLAAGIKLTPAVAILVFLARREWRAAATMA
GSAVGLTALAGLFAPTESWRFFTWAMWDPGRAGFADYSGNQNFKGAIARALPEPAWNPTW
AACSLLTVLAAWLLCRRLDRLRDPDVEAGDAGLVLALQVNVVMVLGLLISPISWSHHWVW
CLPALVSVGAAAWRWRSATLGVAGLAGILVFVLAMQWWFPEQNHVEQSWPAWAKVVGSSY
TWWALGCGAALWWAAGRRQVVSRR

Enzyme Prediction     

No EC number prediction in MGYG000000112_00609.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	106	351	9.4e-58	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	2.99e-34	27	392	1	352	mannosyltransferase; Provisional
pfam09594	GT87	2.09e-29	106	351	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQC21714.1	2.01e-257	1	444	1	466
VEI16848.1	2.74e-246	1	438	1	448
QLF52563.1	1.24e-245	34	438	5	417
QQC41072.1	8.79e-239	34	438	5	417
QCT32348.1	1.80e-238	1	444	1	452

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	3.10e-51	68	425	39	396	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	3.10e-51	68	425	39	396	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	6.48e-44	68	424	41	404	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WN00	1.45e-26	30	443	24	425	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	1.45e-26	30	443	24	425	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999766	0.000230	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
39	61
125	147
159	176
181	200
207	229
298	315
328	350
354	373
380	399
419	436