CAZyme Information: MGYG000000112_01159

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_01159
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	MGYG000000112_1|CGC15	81590.47	4.5767

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 1384541; End: 1386760 Strand: +

Full Sequence      

MNEFNDDQLPASESLKHLAEAYGVSTEYWDYHGNLASPSSATLKAVLTALGVRARTDEEI
ETSLKEVEDAPWRRTLAPTVVTRGGVESTVPVYVPDGARVRVRVELEGGEVRDLTQTEDW
TVPREVDGIKRGRASFILGADLPLGWHRLIAEVSPGSDSGDQAALQGAHAAPPADAEAET
VTVTSALAVTPNHLDLPEALGDRGWGVMTQLYSIRSRGSWGTGDTDDLTELASFLGDQGA
DFLLINPLHAAEPVAPMTPSPYLPVTRRFVNPLYIRPENIPEVARLSGPKRSLVQWAFEE
VEDSDLSAEPIDRDAVWKAKREALEVIFAAGRSYSRQRDFERFRAEQGEGLERFALWSAL
IEKHGPLETWPATLREANSAYVANEAHLLAERIDFFAWLQWIVDEQLARAQAQALASGMA
LGIMDDLAVGVHSQGADVWSNPEAFASGVTVGAPPDMYNQQGQNWSQPPWNPEYLARSAY
APLRDMVRTVLRHAGALRVDHVIGLFRLWWIPEGMGADRGAYVRYDHEAMLGVVLLEAYR
AGAVVIGEDLGTVEPWARDYLASRGVLGTSVLWFEKQHDGWPLQPQDYRRLALSTVNTHD
LPPTAGYLADEHVELRERLGLLTEPVEQVRTEARIERDRMTARLREHGLLGEAPTERQVV
EALHRYVVRTPSVLVGIALVDGVGERRAQNQPGTDQEYPNWRIPLADGAGEVVLVDDLPE
NARLGSLLSVVRDEMTSSS

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	210	718	1.4e-143	0.9696356275303644

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14507	PRK14507	1.00e-157	11	739	4	725	malto-oligosyltrehalose synthase.
COG1640	MalQ	5.07e-149	205	724	14	511	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
pfam02446	Glyco_hydro_77	8.94e-147	210	705	2	459	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
PRK11052	malQ	1.82e-128	14	702	5	662	4-alpha-glucanotransferase; Provisional
PRK14510	PRK14510	3.03e-108	203	705	723	1194	bifunctional glycogen debranching protein GlgX/4-alpha-glucanotransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI15651.1	0.0	1	736	1	736
QQC21981.1	0.0	1	739	1	736
QQC40215.1	0.0	1	737	1	735
QQQ58587.1	0.0	1	737	1	735
QLF53870.1	0.0	1	737	1	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5B68_A	4.86e-202	9	721	1	693	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
4S3P_A	1.31e-86	12	706	3	664	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	9.98e-83	12	706	3	664	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WK22	2.49e-231	14	737	7	719	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	2.49e-231	14	737	7	719	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	2.49e-231	14	737	7	719	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1
P45176	3.87e-87	187	706	130	674	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P15977	6.86e-86	12	706	3	664	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000112_01159.