CAZyme Information: MGYG000000112_02440

Basic Information

• Species: Actinomyces sp900323545
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Actinomyces; Actinomyces sp900323545
• CAZyme ID: MGYG000000112_02440
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000112_3|CGC4	30510.18	4.7199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000112	3112947	Isolate	Canada	North America

• Gene Location: Start: 589849; End: 590763 Strand: -

Full Sequence      

MTPTTQRHTHALPQELDAPAAPDATQARRGVRAMVLRAGLAALALSVAVSGGAYAAVQVG
ERGRASGADAADQRIDALDAEGAHGGVSVSSSTSTLTTETVDTTDPHGSLQQESSDLPQG
ESKVATPGVDGVVRTTYEVTTVDGKEVSRRPIAQVVVTQKVDEVVLVGTGAAKKQEQSQP
QAQAPAPSASPDSSSGSDGSGGSGGSGGSASAGGSGDSGGGTSEVGDDVWGRLAQCESGG
NPKTNTGNGFYGMYQFTLSTWQSLGGTGYPHEADAATQTAMAKKLQAQAGWGQWPACADK
LGLR

Enzyme Prediction     

No EC number prediction in MGYG000000112_02440.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13925	RPF	2.27e-25	228	297	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam06737	Transglycosylas	5.58e-23	227	297	2	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
pfam07501	G5	1.22e-20	112	169	17	74	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
COG3583	YabE	6.59e-12	112	179	226	294	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
cd00442	Lyz-like	0.002	229	284	1	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI18258.1	4.75e-113	1	303	1	287
QCT34052.1	2.33e-112	1	304	1	304
QQC21019.1	2.67e-112	1	304	1	308
AMD99066.1	1.53e-103	1	304	1	295
QQC39727.1	1.10e-101	1	304	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EO5_A	5.50e-22	106	304	16	171	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
5E27_A	2.94e-21	106	304	93	248	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4KL7_A	2.03e-18	229	304	2	80	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	2.08e-18	229	304	3	81	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	3.09e-18	225	304	26	108	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O86308	6.77e-25	228	303	45	120	Resuscitation-promoting factor Rpf OS=Micrococcus luteus OX=1270 GN=rpf PE=1 SV=2
P9WG29	8.24e-20	106	304	207	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
P9WG28	8.24e-20	106	304	207	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
H8EZH5	8.24e-20	106	304	207	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
Q6M6W5	9.80e-19	223	303	34	117	Resuscitation-promoting factor Rpf1 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.337135	0.654472	0.005097	0.002021	0.000804	0.000460

TMHMM  Annotations     

start	end
35	57