CAZyme Information: MGYG000000113_00062

Basic Information

• Species: Streptococcus salivarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus salivarius
• CAZyme ID: MGYG000000113_00062
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000000113_1|CGC2	22815.91	6.0965

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000113	2251845	Isolate	Canada	North America

• Gene Location: Start: 66418; End: 67029 Strand: -

Full Sequence      

MFKWIRRLAVFVVVLIIGIQCYRIHANIQHVLTYESMVKEVLAEDDIDNTTNVDLVLAMI
YTETKGKTDDVMQSSESSTGVTNSITDRKESIRQGVTVLSENLEEAAHHKVDPWTAVQAY
NFGKAYIDYVADNGGVNTVELAKAYSKNVVAPSLGNTSGQTYTYYQPVAMYYGGGKLYTN
GGNIYYAKEVQFNLFLMRMFSRL

Enzyme Prediction     

No EC number prediction in MGYG000000113_00062.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	3.51e-86	29	194	2	165	Lysozyme-like.
cd16891	CwlT-like	1.42e-62	34	191	1	147	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH69912.1	2.43e-139	1	203	1	203
QEM32855.1	2.43e-139	1	203	1	203
ARC49578.1	2.43e-139	1	203	1	203
ARI57108.1	2.43e-139	1	203	1	203
AMB82934.1	9.88e-139	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	3.27e-14	31	190	26	174	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.53e-13	31	190	24	173	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99ZN9	4.79e-72	1	201	1	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1
Q8P120	1.37e-71	1	201	1	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q5XC63	2.75e-71	1	201	1	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
P0DC90	1.11e-70	1	201	1	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) OX=198466 GN=pvaA PE=3 SV=1
P0DC91	1.11e-70	1	201	1	197	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M3 (strain SSI-1) OX=193567 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.232370	0.065450	0.700896	0.000199	0.000180	0.000893

TMHMM  Annotations     

start	end
7	26