CAZyme Information: MGYG000000113_01254

Basic Information

• Species: Streptococcus salivarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus salivarius
• CAZyme ID: MGYG000000113_01254
• CAZy Family: GT8
• CAZyme Description: Glycosyltransferase-stabilizing protein Gtf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		49920.09	4.3759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000113	2251845	Isolate	Canada	North America

• Gene Location: Start: 57841; End: 59139 Strand: +

Full Sequence      

MLIIAQEPSQATEKLRRSLDSFGIQSRVFYTNFETDIDKDTISLASSFIYSSEEDYQGKP
LFFNDLSVPLYWELWTLGITTYIFDGQDRRASVIFRDNLKERTVKQVQWFGQGEKVVAID
DYNRYGWRTKQRLLDDQGQGIMDTYFNHNQEEVLLHYIQDGYLIDQGSEGRDRIFSGREE
LTKVVLNQVLKSDEAIICMDSNLIPILQTLNANRLVYCSDSHDGLEFIQSQVNHVLITNY
YPQEERLLGMIYLAGAKQEGSQTFVPQAMVMTASENIEGLADLVDAFPDIDFHIGAQTSM
GPKLTCLEDKGNVHLYPGIRQEKYQELLRKCFIYLDLNYGSEVSDATLDAIENGQLLYGL
ESTVHRHYYKNLPTVYTSLEELEQGFRQLLQQPEFYPKSLESQKEILKLAEREEILAFFT
RLEGEEDDNLHL

Enzyme Prediction     

No EC number prediction in MGYG000000113_01254.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02919	TIGR02919	1.19e-50	50	366	48	383	accessory Sec system glycosyltransferase GtfB. Members of this protein family are found only in Gram-positive bacteria of the Firmicutes lineage, including several species of Staphylococcus, Streptococcus, and Lactobacillus. [Protein fate, Protein modification and repair]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC23040.1	5.02e-313	1	432	1	432
CCB96003.1	9.71e-311	1	432	1	432
ARC49142.1	1.13e-309	1	432	1	432
ALR80555.1	2.01e-303	1	432	1	432
ARC33121.1	3.33e-302	1	432	1	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E9U_B	9.16e-25	9	368	9	389	Crystalstructure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_D Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_F Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_H Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]
5E9T_B	9.24e-25	9	368	9	389	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_D Crystal structure of GtfA/B complex [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3S2Y1	3.26e-31	1	365	1	383	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus agalactiae OX=1311 GN=gtfB PE=1 SV=1
A0A0S4NND9	6.07e-31	59	365	56	379	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtfB PE=3 SV=1
A0A0H2UR90	1.64e-27	1	369	1	387	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gtfB PE=1 SV=1
Q79T00	2.43e-25	9	368	9	389	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus gordonii OX=1302 GN=gtfB PE=1 SV=1
A1C3M0	7.47e-25	9	365	9	382	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase stabilizing protein GtfB OS=Streptococcus parasanguinis OX=1318 GN=gtfB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999966	0.000078	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000113_01254.