CAZyme Information: MGYG000000113_01766

Basic Information

• Species: Streptococcus salivarius
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus salivarius
• CAZyme ID: MGYG000000113_01766
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210		22047.99	3.8382

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000113	2251845	Isolate	Canada	North America

• Gene Location: Start: 62163; End: 62795 Strand: -

Full Sequence      

MKTTKKAALAVASSALLLGLTVAQTVNADTYTVQNGDSFFGIASQYGVDPYQLAAENGMT
IWSTIVPGGSLEVSGATTAVEETTEASSSEVAATDSDATWNRYPVGQCTWGVKEVAPWAS
NWWGNGGDWAGSAASQGYAVGSTPVTGSIVCWTDGGYGHVGYVTEVGQDGQIQILESNYN
NQQQINNYRGWFDPQNSTTPGSVSYIYPGA

Enzyme Prediction     

No EC number prediction in MGYG000000113_01766.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3942	COG3942	2.07e-19	101	177	66	146	Surface antigen [Cell wall/membrane/envelope biogenesis].
PRK08581	PRK08581	7.22e-14	103	177	508	592	amidase domain-containing protein.
pfam05257	CHAP	1.63e-13	99	177	1	82	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
cd00118	LysM	3.92e-08	30	68	2	40	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.56e-06	30	68	1	39	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMI51694.1	3.07e-150	1	210	1	210
ARI58349.1	3.07e-150	1	210	1	210
QKH70415.1	3.07e-150	1	210	1	210
AMB83476.1	1.25e-149	1	210	1	210
AIY21859.1	1.25e-149	1	210	1	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CGK_A	3.46e-37	103	207	287	390	Crystalstructure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39],4CGK_B Crystal structure of the essential protein PcsB from Streptococcus pneumoniae [Streptococcus pneumoniae D39]
2K3A_A	1.27e-18	82	180	31	130	ChainA, CHAP domain protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 = NCTC 7292]
2LRJ_A	4.34e-14	101	179	9	88	ChainA, Staphyloxanthin biosynthesis protein, putative [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DVU8	5.98e-75	5	208	7	210	Putative hydrolase SMU_367 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=SMU_367 PE=3 SV=1
Q2G0D4	3.98e-20	24	189	84	251	Probable autolysin SsaALP OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_00671 PE=1 SV=1
Q49UX4	2.41e-18	30	207	151	325	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q2YVT4	1.30e-17	31	189	160	321	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=sle1 PE=3 SV=1
Q6GC24	2.30e-16	31	189	160	320	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000210	0.999104	0.000176	0.000177	0.000164	0.000146

TMHMM  Annotations     

start	end
7	26