CAZyme Information: MGYG000000114_00115

Basic Information

• Species: Streptococcus sp902363395
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp902363395
• CAZyme ID: MGYG000000114_00115
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	MGYG000000114_1|CGC2	79780.34	6.4426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000114	2012808	Isolate	Canada	North America

• Gene Location: Start: 120849; End: 123020 Strand: +

Full Sequence      

MRKKDFIYFASAAVLLAASVQVANADEVGVKESAVTESEAVTTQASPAPVVEAKQEVGAH
QYVAPASVTELPVTSSEVTKADEPKEETQPISEGQTAPSSESATKPVTGTTTFYSAGSKA
PSGRTVSTLNRPQGDLSIENNNEVTGTFDAVVRNVVSPSGLKEVLIPSWSVAGWQDDLIW
HKASLQSDGSYRATIKASDHKNSVGQYQVHVHYLDQENRRRYVTETVVEVRQSKPSGTLS
IENNNSSTGTFDAVIRDVVAPNGLKEVLVPTWSDKNWQDDLIWHKAVRQSDGSYRATIKA
SDHKNDIGKYHVHVYFIDAKNHRNYVTETITEVRQVKPSGTLSIENNNSSTGTFDAVVRN
VVAPTGLKEVLIPSWSVEGGQDDLIWHKAVRQSDGSYRATIKASDHKNTLGQYQVHVHYL
DQNNRRRYATETVVEVQKTTPTGTITIQNNNKDNGTFDVIISNVYSPKGVRAVQVPTWSD
VNGQDDLAWYEAIRQSDGTYKLSVKASDHKFSTGTYHVHLYYIQGDDSRVGIGATTVQVE
NKSFVTRNQLYLKHISAREADGQLGRVLKAATSLIGVETGTPEHLKLVKDYNSVYPLPVG
YPVKSTDDWCDVFVTTVFQREGLSHLIGRECGVERHIQIFKNLGIWNEDGASTPKSGDII
TFNWDQDYQQNDGWADHIGIVEYVENGLIHTIEGNSGEAGTVKRNVYRIGHGNIRGFATP
RYN

Enzyme Prediction     

No EC number prediction in MGYG000000114_00115.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08481	GBS_Bsp-like	6.07e-32	447	535	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	2.34e-27	344	432	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	8.45e-27	241	329	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	5.37e-26	138	226	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam05257	CHAP	2.35e-07	650	695	42	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMP67394.1	0.0	131	722	466	1057
AVH83906.1	9.97e-292	131	722	688	1365
AAN64579.1	9.97e-292	131	722	688	1365
ATF64626.1	1.99e-291	131	722	688	1365
SQG04993.1	3.50e-289	107	722	465	1159

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000303	0.998961	0.000230	0.000178	0.000163	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000114_00115.