CAZyme Information: MGYG000000114_00945

Basic Information

• Species: Streptococcus sp902363395
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp902363395
• CAZyme ID: MGYG000000114_00945
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200		23066.47	8.9994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000114	2012808	Isolate	Canada	North America

• Gene Location: Start: 1030369; End: 1030971 Strand: +

Full Sequence      

MMKRIIKIFFCLLLIFFIYKGYQIHRDVKQVMTYRTLVREVLAEEDTGTNEDLILAMIYT
ETKGKENDVMQASESATGQTNSITNNKESIRQGIQTLSENLRKAKEKGVDPWTAVQAYNF
GQDYIEYVAKNGGKNSLELARKYSKEVVAPSLGNVTGKTYLYLHPISFLHGSELYVNGGN
YYYSRLVEMNQFIMKLFSWF

Enzyme Prediction     

No EC number prediction in MGYG000000114_00945.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	8.10e-82	28	190	1	164	Lysozyme-like.
cd16891	CwlT-like	1.66e-66	34	187	1	146	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG0741	MltE	2.32e-05	12	190	104	279	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEE19770.1	4.73e-140	1	200	1	200
AGY39690.1	4.73e-140	1	200	1	200
VED67249.1	4.73e-140	1	200	1	200
AMP66651.1	2.74e-139	1	200	1	200
SQH66359.1	1.30e-137	1	200	1	200

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FDY_A	1.97e-17	30	188	25	175	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]
4HPE_A	1.22e-15	30	193	23	177	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AHT6	1.94e-88	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=pvaA PE=4 SV=1
Q8DPY9	5.55e-88	1	200	1	200	Pneumococcal vaccine antigen A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pvaA PE=4 SV=1
Q8P120	3.20e-74	2	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) OX=186103 GN=pvaA PE=3 SV=1
Q5XC63	6.44e-74	2	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) OX=286636 GN=pvaA PE=3 SV=1
Q99ZN9	1.30e-73	2	200	1	199	Pneumococcal vaccine antigen A homolog OS=Streptococcus pyogenes serotype M1 OX=301447 GN=pvaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.726616	0.157703	0.113163	0.000525	0.000350	0.001652

TMHMM  Annotations     

start	end
5	24