CAZyme Information: MGYG000000115_01386

Basic Information

• Species: Clostridium_J sp902363375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium_J; Clostridium_J sp902363375
• CAZyme ID: MGYG000000115_01386
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		40259.33	4.5116

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000115	3522150	Isolate	Canada	North America

• Gene Location: Start: 1472216; End: 1473274 Strand: -

Full Sequence      

MNNRMKIIGIFIIALVIIMTLNGCIRKKNTTESNESQNKEVTSSKDYEIFDEDIDSLSAW
IAYWDLNVQGEIDALNNELKEVSYFAAYFNSDNELIIPEELINYYNKTRDKEYIKYLTIV
NDKTNSDGTSSLKDTELLKEVLSDSSSRSNHIKDIITLASKYNFHGIEIDYEQIKDDMEL
WNKYLLFIKELYNAAKESGFKVKVVLEPNTPFDKLEFVEGPTYVMMCYNLHGGFSEPGEK
ANPKFINELINKMETVPGNKSFAIATGGFNWASDGKVTSLSEREAKELVKDYSAEEIRDD
ESNCLVFKYTDKAGVNHEVWYADKNTLGSWMKIINDNGYGVSLWKLGGNVFN

Enzyme Prediction     

No EC number prediction in MGYG000000115_01386.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	75	349	4.8e-19	0.8412162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	6.96e-38	79	347	26	303	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd06549	GH18_trifunctional	3.22e-33	115	348	61	292	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
COG3858	YaaH	1.16e-21	86	347	134	408	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
pfam00704	Glyco_hydro_18	5.73e-11	82	348	3	306	Glycosyl hydrolases family 18.
smart00636	Glyco_18	2.24e-09	141	348	85	333	Glyco_18 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKN29836.1	9.99e-144	11	351	7	347
AKA69491.1	8.86e-140	11	351	7	347
AWI04411.1	5.09e-139	11	351	7	347
AOR95075.1	5.72e-125	1	351	1	343
ANF15066.1	5.72e-125	1	351	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	1.24e-13	74	347	128	411	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	2.27e-13	135	346	83	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4WIW_A	1.42e-06	138	347	87	330	ChainA, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_B Chain B, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_C Chain C, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_D Chain D, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_E Chain E, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2],4WIW_F Chain F, Glycoside hydrolase family 18 [Desulfitobacterium hafniense DCB-2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32258	1.48e-15	134	347	102	329	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1
O05495	2.71e-13	135	346	175	400	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
P0DPJ9	1.21e-12	74	347	127	410	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	1.21e-12	74	347	127	410	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000055	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	25