CAZyme Information: MGYG000000116_01510

Basic Information

• Species: Exiguobacterium_A sp902363455
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium_A; Exiguobacterium_A sp902363455
• CAZyme ID: MGYG000000116_01510
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000000116_1|CGC16	25499.49	4.6008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000116	3094176	Isolate	Canada	North America

• Gene Location: Start: 1465685; End: 1466368 Strand: +

Full Sequence      

MRKVFRLSILFVLIVLIGSSIIYWQNRERVQNELYRTYYGQSGVPAENIDIYEQAGDRYG
VDWKLLAAIHRVETIFSKSSAMQSSVGAIGPFQFMPKTWVGWGYEGGTSLGDIEHDGIDL
TDPDAIKQYGGLGVDANGDGKADPTDLTDSAHTAAKYLNQHDVTKSSDRATLESALFEYN
RSEQYVSDVLDQYDAYQQQIEPIDVNALDFKKQTLAQLLRISLRLTN

Enzyme Prediction     

No EC number prediction in MGYG000000116_01510.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	199	1e-19	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	4.22e-24	59	192	1	105	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	8.21e-10	43	162	107	240	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.95e-06	54	161	3	77	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	7.46e-05	8	123	99	207	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd13401	Slt70-like	9.71e-05	50	124	8	76	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFS70330.1	5.43e-157	1	227	1	227
ACB60721.1	2.37e-151	1	227	1	227
QNR20861.1	1.37e-150	1	227	1	227
QWB31317.1	1.18e-135	1	227	1	227
ASI35177.1	1.18e-135	1	227	1	227

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.749106	0.233768	0.013896	0.000625	0.000459	0.002153

TMHMM  Annotations     

start	end
7	24