CAZyme Information: MGYG000000116_01530

Basic Information

• Species: Exiguobacterium_A sp902363455
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium_A; Exiguobacterium_A sp902363455
• CAZyme ID: MGYG000000116_01530
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000116_1|CGC17	47158.34	7.3422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000116	3094176	Isolate	Canada	North America

• Gene Location: Start: 1490516; End: 1491745 Strand: -

Full Sequence      

MNLILNGIMAIFWLMLLYYSFLTLAGIIDRYSKQKRPSLEYYPSVAILIPAHNEGVVMQQ
TLEAMMAIEYPGQLDVFLLDDQSQDETNQIAREFTTLFSRIHYIKVPKGEPIGKSRVLNY
GLTITDSEYFLIYDADNQPKPDAVTKLVEQAVTTKNACGAVGVVKTINAETNTLTRMIAI
EFQVFQLIMQSGRWRAFKTGSLAGTNMLLKRSVIEELGGYDPYALAEDAELTMRVTALGY
TLPVVYTAETWEQEPESMKVYMKQRTRWMLGNIYLLEKAFLTRDFWRGRTLVHSLQHIMT
YLLFIFLLLISDIVLILGLFGYAFDEATTPLIMFWFMTYLVYTIQILAAQELEKTATPRN
VLIGLIMYFTYAQLFVILLFRGMFAYIKSKIRKETIVWDKTKRVKIEQS

Enzyme Prediction     

No EC number prediction in MGYG000000116_01530.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	43	271	2.2e-36	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	5.44e-54	47	228	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	6.61e-48	8	404	21	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06427	CESA_like_2	6.54e-42	43	271	1	229	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
cd06421	CESA_CelA_like	6.46e-35	43	276	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	1.12e-30	43	271	1	231	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZY87998.1	1.31e-255	1	407	1	407
AHA29480.1	3.74e-255	1	407	1	407
ASI35158.1	1.76e-251	1	409	1	409
AWD68714.1	1.87e-188	9	407	1	399
QDP41104.1	9.37e-184	1	405	1	405

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	2.84e-78	9	403	10	413	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q3MB01	7.53e-19	30	271	96	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	1.36e-18	30	271	96	333	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q8GLC5	4.73e-17	9	286	14	280	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	6.36e-17	9	286	14	280	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.989469	0.010482	0.000041	0.000013	0.000012	0.000044

TMHMM  Annotations     

start	end
4	26
268	287
302	324
331	348
363	385