CAZyme Information: MGYG000000116_02160

Basic Information

• Species: Exiguobacterium_A sp902363455
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium_A; Exiguobacterium_A sp902363455
• CAZyme ID: MGYG000000116_02160
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40747.02	8.7293

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000116	3094176	Isolate	Canada	North America

• Gene Location: Start: 227670; End: 228746 Strand: +

Full Sequence      

MMIFLFCIIALICLYTFINLSFLPRLADPVPLPSLAVCIPLRNEERNVSKLIYSLKQAIT
PNTHVYLYEDRSTDQTRPLLIQLVGQDSRFTIIDGLELPSGWAGKVHACHQLSRVAQEDY
LLFLDADITLEVDTIPRLYATLLQERAVFLSGFPSFPVPTFLGKCLIPMQHVLIAQHLPI
AFRKVRHPAFAAANGMVVLVERHAYEQVGGHQAIQLALVDDLELCRAFKKKGFTTTLVHV
APYVSCDMYATNQDVWQGFLKNVFRGMNDSYLVGSYFLLFYLIQAAVLPLLIWSPSVWTA
GAFVLMMLARYQIDRNAQIVHAWFWHPVSAVLYVVLLATAMIRRLKKREITWKGRTYS

Enzyme Prediction     

No EC number prediction in MGYG000000116_02160.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	37	161	5.5e-17	0.7176470588235294

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00761	Glyco_tranf_GTA_type	6.51e-14	37	156	1	116	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	1.77e-13	3	355	24	380	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	4.68e-13	37	147	2	108	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04192	GT_2_like_e	7.28e-13	37	261	1	221	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06423	CESA_like	1.55e-09	39	210	3	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACB60220.1	5.11e-216	1	358	1	358
QNR20367.1	5.95e-215	5	358	5	358
AFS69858.1	6.62e-212	11	358	11	358
ASI34708.1	1.58e-196	11	358	11	358
AHA29047.1	1.23e-193	12	358	12	358

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2YWE6	1.03e-12	34	270	40	273	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=crtQ PE=3 SV=1
Q4L977	6.57e-08	34	270	42	276	4,4'-diaponeurosporenoate glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=crtQ PE=3 SV=1
P75905	4.14e-06	24	209	69	246	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	4.14e-06	24	209	69	246	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.952797	0.046901	0.000112	0.000067	0.000046	0.000106

TMHMM  Annotations     

start	end
4	23
271	293
323	345